KEGG   Phaeosphaeria nodorum: SNOG_15083Help
Entry
SNOG_15083        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pno  Phaeosphaeria nodorum
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SNOG_15083
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     SNOG_15083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 443 aa AA seqDB search
MALNTGHEDPFRDPSLAATSQARPQASDNVQYDARNPDGVKSLILAENKSTHSIPFYNIL
WAEHSDDGNVTIQYAQTIAKKSVRPAIVSYKLDKPDSTRAEAWIEKLLDRAYGASQRQKR
IKVLVNPFGGQGGAVKTYHKMIAPILAAARCELDNLDIEAYDVVACCSGDGIPYEVFNGL
GKRSDAALALHKIAVVQLPCGSGNAASLNFNGTNNPSLAALAIVKGLRTPLDLSSITQGT
TRTLSFLSQTVGIVAEADLATEHLRWMGSARFTWGVLVRIFKKKVYPADIAVKVEHDTKA
AVREAYRAGASKPLGPDDRPVPDSNTGLPPLKYGTINDALPTDWESIPQPHLGNFYAGNM
AYMSPDANFFPASLPSDGCLDLVRIRGDLPALAAIKTMTAIENNTFFDMEHVDYKKVSAY
RIVMREKEGYGVGHGVEQEWEGL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggctcttaatactggacatgaggacccctttcgcgacccttcgctcgctgcgacgtcg
caagcacgtccgcaggcatccgataatgtgcagtacgatgcacggaaccccgatggtgtg
aagtcgctcatattagcagagaacaagtcgacacactcgatacctttctacaacattctt
tgggccgagcactccgacgacggcaacgtgactatccagtatgcgcagactatcgcaaag
aagtcggttcgacccgccatcgttagctataaactagacaagccagacagcacgcgggct
gaggcgtggattgaaaaactgctggaccgcgcgtatggagcttcacagcggcagaagcgc
atcaaggtgctggtgaatccgtttggagggcagggcggcgcggtcaagacatatcacaag
atgatcgcgcctatcctggctgctgcgcgctgcgagctggacaacctggacatcgaggcc
tacgacgtggtcgcatgctgctcaggcgacggcatcccctacgaagtcttcaacggcctg
ggcaagcgatccgacgccgccctcgccctccacaaaatcgccgtcgtccagctcccctgc
ggctccggcaacgcggcaagcctcaacttcaacggcaccaacaaccccagcctcgccgct
ctcgccatcgtcaagggcctgcgcacgcccctcgacctctcctccatcacccaaggcacc
acacgcaccctctccttcctctcccagaccgtcggcatcgtcgccgaagccgacctcgcc
accgaacacctccgctggatgggcagcgcgcgcttcacatggggcgttctcgtgcgcata
ttcaagaagaaagtctaccccgcggacattgccgtcaaagtcgagcacgacaccaaagca
gctgtccgcgaagcataccgcgccggcgcatccaagcccctcggccccgacgaccgcccc
gtccccgactccaacacgggccttcctcccctcaaatacggcaccatcaacgacgccctg
cccacagactgggaatctatccctcagccgcacctcggcaacttctacgccggcaacatg
gcctacatgtcgcccgacgcaaacttcttccccgcctccctgccctccgacggctgtttg
gatctcgtgcgcatccgcggcgacttgcctgccctcgcggctatcaagactatgacggcg
attgagaataataccttctttgacatggagcatgtggattataagaaggttagtgcgtat
cgcattgttatgcgggagaaggagggctatggggttgggcacggtgttgagcaagagtgg
gagggtttgtga

DBGET integrated database retrieval system