KEGG   Phaeosphaeria nodorum: SNOG_15278Help
Entry
SNOG_15278        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pno  Phaeosphaeria nodorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pno00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 600 aa AA seqDB search
MLLTSFLSALPAALLLVGAQGSPFPGNDGARQQTALDLFIEAQANVSINGIFANMGPDGS
KAQGAAEGVVIASPSRSDPDYWFTWTRDSALTYKMLIERFVAGDQSLKQKIDDYVSTQAE
LQGVTSPSGSPDNGGLGEPKFNVDRTAFTGPWGRPQRDGPALRATALTIYANYLAANGAS
TQVANIVWPVIAKDLAYVVRYWNQTGFDLWEETNGSSFFTLSASHRALVEGAALATKLGK
TCDGCAEAAPQVICFVQSFWTGSYIDSNINLNDGRTGKDANSLISTIHTFDPNSKCTDAT
FQPCSSRALANHKAVTDSFRSVYAINEGIPQGQAVGVGRYSEDVYFNGNPWYLTTTAAAE
QLYSAAYQWNKLESITVDAVSLPFFNDLLPNVAVGTYAKDSATYTSIIHAVKTYADGYMA
IVMKYTPANGGLSEQFNKANGSPVSAVDLTWSYAAFITATERRNGVVSPSWDESSNNVPP
ETCTGTPACISRTTFNVLATTDLGQEVFVVGQLTELGNWAPVGAQALSASQYTGSNPPWS
GTIDLPAGTIFEYKYIKKTSDGQVFWQAGANSKFTTSTECDSTTTISDGSVTFESWSYPQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcacatcgtttctaagtgcccttccggcagccctactcctggttggcgctcaa
ggttcgcctttccctggaaatgatggtgcgagacagcaaactgcactcgacctgttcatc
gaagctcaagcaaatgtctccatcaatggcatattcgcaaacatgggtcccgatggctcc
aaggcgcagggtgccgcggagggcgttgttatcgccagcccatcacgatctgacccagat
tactggttcacgtggactagggattccgcattgacctataagatgcttatcgaacgtttt
gttgccggagatcaatcactcaagcagaagattgatgattatgtgtctacacaagccgaa
cttcaaggtgtcacgagcccatctggcagccctgacaatggaggacttggtgagcccaag
tttaacgtcgacaggaccgcctttaccggtccttggggtcgtcctcaacgtgatggacca
gctcttcgtgccactgcgctcaccatttatgccaactacctcgctgccaatggcgcatcc
acccaggtagccaatattgtttggcccgtcatcgcaaaagacctcgcatatgttgtacgt
tactggaaccagactggcttcgacttgtgggaggagaccaacggctcatcgttcttcact
ctgtcggcttctcaccgcgctcttgtcgagggcgctgctcttgcgactaaacttggtaag
acatgcgatgggtgtgccgaagctgctccccaggtaatctgtttcgtccagagcttctgg
actggaagttatattgactccaacatcaacctcaacgatggtcgcactggcaaggatgcc
aactctcttatctctacgatccacacttttgaccccaattcgaagtgcaccgatgccact
ttccagccttgctcgtctcgggctcttgccaaccataaggccgttaccgactcttttcgc
tccgtgtacgccatcaacgaaggtattccgcaaggtcaagccgtcggtgtcggaagatat
tctgaggacgtttactttaatggcaacccgtggtacctgactacgactgctgccgcagag
cagctctattccgctgcctatcaatggaacaagctggagtctattaccgtggacgccgta
tccctaccgttcttcaacgacctcttacccaacgtcgcggtcggcacctatgccaaggac
tctgcgacctacacttcgatcatccacgccgtcaaaacatatgctgatggctacatggcg
attgttatgaaatacacacctgccaacggcggtctttcagagcagttcaacaaggcaaat
ggctctcctgtttccgccgttgacctgacctggtcgtacgccgccttcattaccgcgact
gagcgccgcaatggtgtcgtaagcccatcttgggacgaatcatccaacaatgtaccgcca
gaaacctgcaccggaactcctgcctgcatctccaggacaactttcaacgttctcgccact
accgaccttggccaggaggtcttcgttgtcggccaattgacggaacttggcaactgggcc
cctgtaggtgctcaggcactcagcgcgagccagtacaccggcagcaacccgccttggagt
ggaaccatcgatcttccagccggtactatctttgagtacaagtacatcaagaagacttcc
gatggtcaagtgttctggcaagcaggggcaaacagcaagtttaccactagtaccgagtgc
gacagtactacaacgatcagtgacgggagcgtgacattcgaaagctggagttatccacaa
tga

DBGET integrated database retrieval system