KEGG   Phaeosphaeria nodorum: SNOG_15648Help
Entry
SNOG_15648        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pno  Phaeosphaeria nodorum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pno01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pno00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pno00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pno00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pno00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 670 aa AA seqDB search
MSEGNTKPSVPVVAEAHDVDTFHVPKAFLEKHPHSKPHINGLEEYQKLYKESITEPKQFW
GRLARELLTWDRDFQTVHSGSFQGGDNAWFLEGRLNASYNCVDRHAFKNPDKPAIIYEAD
DTEDGRIISYGELLRQVSKLAYTLKEMGVRKGDTVALYLPMIPEAVISFLACSRIGAVHS
VVFAGFSSDSLRDRIIDAECKVVITTDEGKRGGKVISTKKIVDEALKQCPGISHCLVYKR
TGAEIPWTKGRDWWWHEEVEKYPNYIAPEPMNSEDPLFLLYTSGSTGKPKGVMHTTGGYL
LGAAATGKYVFDIHDNDTFFCGGDVGWITGHTYVVYAPLLLGVATVVFEGTPAYPNFSRY
WDIVDKYNVTQFYVAPTALRLLKRAGDEHVKHQMKHLRILGSVGEPIAAEVWKWYFETVG
KEEAHVIDTYWQTETGSHVITPLGGVTPTKPGSASLPFFGIEPAIIDPVSGEEIHGNDVE
GVLAFKQPWPSLARTVWGAHQRYMDTYLNVYKGYYFTGDGAGRDHEGYYWIRGRVDDVVN
VSGHRLSTAEIEAALIEHHSVAEAAVVGINDELTGQAVNAFVALKDGTESSDQVKKDLIL
QVRKSIGPFAAPKAIFVVPDLPKTRSGKIMRRIMRKILAGEEDQLGDTSTLSDPSVVDKI
IEIVHQSKKK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggcaacacgaagccatccgtgcccgttgtggccgaggcgcacgatgtcgac
actttccatgtgcccaaggcattcctcgagaaacacccgcattcaaaaccgcacatcaac
ggcctcgaagagtaccagaaactgtacaaggaatccatcacagagcccaagcagttctgg
ggccgtctggcgcgcgaactcctcacgtgggaccgcgatttccaaacagtgcactctggc
agcttccagggcggcgacaatgcgtggttcctcgagggcaggctgaatgccagttataat
tgtgtcgaccgccatgcgttcaagaacccggataagccggccatcatctacgaggctgac
gacaccgaggatggccgcatcatttcgtacggcgagctactgcgccaggtctcgaagctg
gcgtacacgctgaaggagatgggtgtgcgcaagggagacactgttgcgctgtacctgccc
atgattcccgaggctgtgatttcgttcctggcgtgctcacgtatcggtgcggtgcactct
gtcgtgtttgctggtttctcgtccgactcgctgcgcgaccgtatcattgatgcggagtgc
aaggttgtcattaccacggacgagggcaagcgtggcggcaaggtcatcagcacgaagaag
attgtcgacgaggcgctgaagcaatgccccggcatcagccactgtctcgtgtacaagcgc
actggcgccgagatcccatggaccaagggacgagactggtggtggcacgaggaggtcgag
aagtaccccaactacattgctcccgagccgatgaactcggaagacccgctgttcttgctg
tacacatctgggtcgacgggtaagccaaagggagtgatgcacaccacaggtggttatctc
ctgggagccgcggcgactggaaagtacgtctttgacattcatgacaacgacactttcttc
tgtggtggtgatgttggctggatcactggacacacatatgtcgtatatgcccctctgctg
ctcggtgtggcgaccgtcgtcttcgagggcacacctgcttaccccaacttctcgcggtac
tgggatattgtcgacaagtacaacgtcactcagttctatgttgcccccactgcgctgcga
ctgctcaagcgcgccggtgacgagcacgtcaagcaccaaatgaagcatctcaggattctc
ggatccgtcggcgagcccatcgctgctgaggtgtggaagtggtactttgagactgttgga
aaggaggaggcacacgtaatcgacacttactggcagacggagaccggctcgcatgtcatc
acaccgctcggtggtgtcacacccacaaagcctggttctgcatcacttcccttcttcggc
atcgagcctgctattatcgatcctgtttcgggcgaggagatccacggaaacgatgtcgag
ggcgtgttggcgttcaagcagccatggccaagtctggctcgcacagtctggggcgcacac
cagagatacatggacacatatctgaacgtgtacaagggctactacttcactggagacggt
gccggacgtgaccacgagggttactactggatccgaggccgcgtcgacgatgtcgtcaac
gtctcaggccacagattatcaaccgctgaaatcgaggcagcactcatcgagcaccattct
gtggctgaggccgcggtggtgggtatcaatgacgaattgacaggccaggctgtgaacgcc
tttgtggcactcaaagacggcaccgagtcaagtgaccaggtgaagaaagacttgatcttg
caagtgcgcaagtcgattggaccctttgcggcacccaaggcgatctttgtagttccagat
ctgccaaagacccggtcgggcaagattatgcgtcgcatcatgcggaagatcttggcggga
gaggaggaccagctgggcgacacatctacgctctcggacccttcggtagtggacaagatt
atcgaaatcgtccaccagtctaagaagaaatag

DBGET integrated database retrieval system