KEGG   Phaeosphaeria nodorum: SNOG_15668Help
Entry
SNOG_15668        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     SNOG_15668
Protein kinases [BR:pno01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   SNOG_15668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 563 aa AA seqDB search
MSWKRTERLMDTIKVRVSLRQMVQFGEKPSTGTLFRASQFLSEELPIRLAHRVQELNDLP
DGLNEMPSICRALMGKATPNPSIKQGQYRSAPEHNGNGNGNGSREVKGATSSRRYYAAAD
DGQEWPPELSAYNTKFADTLEKIKRRHDSVVTTVAQGILEWKRKRQRMQIDHNIQAFLDR
FYMSRIGIRMLIGQHIALTDQRARSDPNYVGIICTKTNVRELAQEAIENARFVCEDHYGL
FEAPNVQLVCNNDISFMYVPGHLSHMLFETLKNSLRAVVERHGQDKEDFPVTKVIVAEGK
EDITIKISDEGGGIPRSAIPLVWTYMYTTVDQTPSLDPDFNKSDFKAPMAGFGYGLPISR
LYARYGSRPTSVLAMKAMKLKLSGNVSREVSERRQVGDAEEMFADKGTPWWRNVGMDEGH
HHHHHPNFLTTVLNPPAPAPTFSATQRSLQARNKAYNNTNTNYHHGAAAAAEAESYEARQ
RREEAGRILEREEMLIWWSQARNESVPQTRTHFRNIVLGIEERADVVWREEWELEKDAVG
ASPRGKERERDKGKRRVVSGTRE
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaagcgcaccgagaggctgatggacaccatcaaagtacgtgtctcgctgagg
cagatggtgcagtttggagaaaagccgtccacaggaaccctcttccgcgcgtcacagttc
ctttccgaagagctgcccatccggctagcacaccgcgtgcaggagctcaatgaccttccc
gatggtctcaatgagatgccctcgatctgcagagcgttgatgggaaaagcgacaccaaac
cccagcatcaagcaaggacagtaccggtcagcgccggagcacaacggtaatggcaacgga
aatgggagcagagaggtcaagggagcgacttcgagccggagatactacgccgcggcagac
gacgggcaggaatggccgccggagctgagcgcatacaacaccaagttcgcagacacactc
gagaagatcaagaggcggcatgacagcgttgtgacaaccgtggctcagggtatcctggag
tggaagcgcaagaggcaacggatgcagattgaccacaacatccaagccttcctcgaccgc
ttctacatgtcgcgcatcggcatccgtatgctcatcggccaacacattgccctcacagac
cagcgcgctcgctccgatccgaactacgtgggcatcatctgcaccaagacgaacgtccgg
gaactcgcacaagaggccattgagaatgcgcgattcgtatgcgaggaccactacggcctg
ttcgaggcacccaacgtccagctcgtatgcaacaacgacatcagcttcatgtacgtgccc
ggccatctgtcgcacatgctcttcgagacgctgaaaaactcgctgcgtgccgtggtggag
cgacacggacaagacaaggaagacttccccgtgacaaaagtcatcgttgcagagggcaag
gaggacattacaattaagatttccgatgagggcggcggcataccccgatccgcgatcccg
cttgtgtggacgtacatgtacacgaccgtcgaccagacgcccagtctcgacccagacttc
aacaagagcgacttcaaagccccaatggctgggtttggctacggattgcccatatcacgg
ctctacgcacgatatggttcgcgcccgacgagcgtgctggctatgaaggccatgaagttg
aagttgagcggcaatgttagtcgcgaggttagtgagaggcggcaggtgggtgatgcagag
gagatgtttgcggacaaggggacgccgtggtggagaaatgtcggcatggatgaggggcac
caccaccaccaccatcccaacttcctcaccacggtcctcaaccccccggcgcccgcgccc
actttctccgcgacgcagcgcagcttgcaggcgcgcaataaagcgtacaacaacaccaac
accaactaccaccacggcgcggctgcggcggccgaggctgagagctatgaagcgcggcag
cgcagggaagaagccgggcggattctcgagcgcgaggagatgctgatttggtggagtcag
gcgcggaatgagagtgttccccagacgcgcacgcacttccgcaatattgtgctgggcatc
gaggagcgcgccgatgtcgtgtggagggaggagtgggagttggagaaggatgcagtgggg
gcgagtcccagggggaaggagagggagagggacaaggggaagaggagggttgtgtctggg
acacgtgagtga

DBGET integrated database retrieval system