KEGG   Phaeosphaeria nodorum: SNOG_15751Help
Entry
SNOG_15751        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SNOG_15751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 222 aa AA seqDB search
MAWRSSGDTNEELIDNLKKNGLIETERVKEAMMKVDRAHFAPSSPYRDYPQPIGHAATIS
APHMHANACESLLTHLPPGAKVLDIGSGSGYLTAVLANLVGPKGTVIGIDHIQPLVDMSI
ANLSKSEVGKKMLETGQVKFVLGDGRKGWKEGAPYDAIHVGAAAAEHHAELTEQLKSPGR
LFVPVADGGSQHIYIVDKKEDGSVEKKKLYGVQYVPLTDAPK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcatggcgaagctctggcgacaccaatgaagagctcatcgataatctcaagaagaac
ggtctcatagaaactgagcgcgtcaaagaagctatgatgaaggtcgaccgcgcccatttc
gcgccctcttctccgtaccgggactacccccaacccatcggtcacgccgccaccatctcc
gcgccacacatgcacgccaacgcatgcgaatcgcttctcacacatctgcctcctggcgcc
aaagttctcgatatcggctctggctcaggctacctgaccgccgttctcgccaacctcgtg
gggcccaaagggaccgtgattggaatcgaccacatacaaccactagtagacatgagcatt
gcgaatctgtctaaaagtgaagtaggcaagaagatgctggagacgggacaagtcaagttc
gtgcttggggacgggaggaaaggatggaaggaaggcgcgccgtatgatgcgattcacgtg
ggtgctgcggcggcggaacaccatgctgagttaacagagcagttgaaaagcccagggagg
ttgtttgtgccggttgcagacggtggctcacagcatatttatatcgttgataagaaagag
gatggtagtgtggagaagaagaagctgtatggggtgcagtatgtgccattgactgatgcg
ccgaaatga

DBGET integrated database retrieval system