KEGG   Phaeosphaeria nodorum: SNOG_15934Help
Entry
SNOG_15934        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pno  Phaeosphaeria nodorum
Brite
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     SNOG_15934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MHFSTLTLLLVPTAVFGQSLNAKFKAKGKLYFGTEIDHYHLSNAPLTTIVKNTFGQITNE
NSMKWDAIEPSRGSFNYANADKVVAFAQQNGKLMRGHTLLWHKQLPAWVTSINDRNTLTT
VIQNHVTNVVNHYKGKIVQWDVVNEILGEDGNLRTDSVFTRVLGEDFVGIAFRAARAADP
NAKLYINDYNLDIANYAKTTGMVRQVNKWISQGIPIDGIGSQAHLAAPGGWNPASGVPNA
LKTLAAANVKEISITELDIAGAAASDYLTVMNGCLALQKCVGITVWGVSDKDSWRADSNP
LLFDRNYQPKQAYTTLLNAL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcacttctctactctcactctcctcctcgttcccacggccgtgtttggtcagtcattg
aacgcaaagttcaaggccaagggaaagctgtacttcggtactgagatcgaccactaccat
ctgagcaacgctcccttgaccaccatcgtcaagaacacttttggacagattacgaacgag
aacagcatgaagtgggatgccattgagccatcccggggatcgttcaactacgccaacgcc
gacaaggtcgtcgcctttgcccagcagaatggcaagctcatgcgtggtcacactctcctc
tggcataagcagttgcccgcgtgggtgacatcgatcaacgaccgcaacaccctgaccacc
gtcattcagaatcacgtgaccaatgtcgtcaaccactacaagggaaagattgtccaatgg
gatgtagtcaacgaaatactgggagaggacggcaacttgcgaaccgacagcgtcttcacc
cgcgtactcggcgaagactttgttggcatcgctttccgcgctgctcgtgcggccgatccc
aacgccaaactttacattaacgactacaaccttgacatcgccaactacgctaagaccacc
ggaatggttcgtcaggtcaacaagtggatctcgcaaggcatccccatcgacggtatcggt
tcgcaagcccatctcgctgcgccaggcggatggaaccctgcatctggtgttcccaatgct
cttaagacccttgccgctgccaacgtcaaggagatttccatcactgagctcgacattgcc
ggcgctgcggccagcgattatttgactgttatgaacggctgccttgctctgcagaagtgc
gtgggtatcactgtgtggggtgtatccgacaaggacagctggagggccgactccaacccc
ctgctgttcgacaggaactaccagcccaagcaggcttacaccacccttctcaacgcgttg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system