KEGG   Phaeosphaeria nodorum: SNOG_16079Help
Entry
SNOG_16079        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
pno  Phaeosphaeria nodorum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MIDDEKFEDNTLVKTLNIAKKNWVQSSKSKQIVVARAPKSLVLHVNRSNFDEITGASYKN
TAGVSYPRILDLGNWCLGSAPSGSRQPDMSLEEWPRDPTQSMLMQINEPIVTSPFQYRLR
AAVTHFGSHGNGHYVCYRPHAQNPSQPECSDEDNEQTSTEEQWWRFSDDTVYAVPEEQAH
QANVFMLFYERIDAPNAPETTDSECIPVLLRIPEDAPLPPEVMRVSNVLMDDSSIAIQVS
LPGDEDNLLDLIPSESVINQHSLSSPLDAGEITPTRDDSSHILWSQHQEDITPMRVATDD
TMTEASGVESEDTASTEATSDSETEHRPSPPRAKPVMRVPPHTMRTAGNTAVRGQGSRRS
LPLVSAT
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacgacgagaaatttgaagacaacactctggtcaagaccttgaacattgccaag
aagaactgggtgcagagctccaagtcgaagcagatagtagttgcacgggcacccaagtcg
cttgtactacatgtgaaccgcagtaacttcgacgagatcacaggcgcttcatacaagaat
acagcgggcgtttcgtatccgagaatcctcgacttgggcaactggtgcctgggcagtgca
ccgagcggctctagacagcctgacatgtcattagaagagtggccgcgggaccccacccag
tccatgcttatgcagatcaatgaaccgatcgtcacatctccattccaatatagattgcga
gcggccgtcacccatttcgggtcacatggcaatggacattacgtttgttatcgaccacat
gctcagaacccatcgcagccggaatgcagcgacgaggataacgagcagacttcaacagag
gaacagtggtggcgattcagcgacgacaccgtttacgccgtaccagaggaacaagcccat
caggctaacgtctttatgcttttctacgaacgaatcgacgcgcccaatgctccagaaaca
acggactcggaatgtatcccagtgctcctccgtattccagaagacgcgcccttaccacct
gaagtcatgcgagtttccaatgtgctgatggacgactctagcattgcaatccaggtttct
ttacccggagacgaagataacctccttgatctcatcccatctgagtctgttatcaaccag
cacagcctatcctcgcctttggatgctggggaaatcacacccacacgtgacgattcgagt
cacattctgtggtctcagcaccaggaagacataacgcccatgcgggtggccacagatgac
acaatgacagaggcgagcggggtagagtccgaagatactgcttcaacagaagctacatcc
gattctgaaaccgagcatcgcccctctcctcctagagcaaagccagtcatgcgtgtgccg
ccacacacgatgcggactgctggcaatactgcagtaagaggacaaggcagtagacgaagc
ctgccgttggtgtctgcaacgtag

DBGET integrated database retrieval system