KEGG   Parastagonospora nodorum: SNOG_16508Help
Entry
SNOG_16508        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
pno  Parastagonospora nodorum
Pathway
pno00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SNOG_16508
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     SNOG_16508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 Cyt-b5 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 5983551
NCBI-ProteinID: XP_001806619
UniProt: Q0TVF6
Position
Unknown
AA seq 454 aa AA seqDB search
MADGVYSLEEVGKHTSKTDLWVVVWNHVYDVTKYQEDHPGGKEFLLENAGADATTAYEDI
GHSTDAREILENFRIGKVTDDDWVDHETKKMPDVKPKNVHVVNNLPPPKPHNLHLPLVAG
GLATLIVSIVLGRRFSPDLHHFQTGGFWKGFALSSVASMAIAGYTSLWATKNFNVAHKDF
QSYPAHVKAKSTSARPSQKKNINLGVLNAREYQEFPLKEKFNLSHDTIRFVFSLPNENSV
LGLPTGQHIAIRHDVDGKQLARSYTPTSSNKDTGRLELTIKIYEGGKLTPYLSKLEVGDK
VEIRGPKGEMKYHKNLVKELGMIAGGTGITPMFQIIRRICEDPRDDTKTTLIYANKTEED
ILLKKELDDFAQKYDQFKIQYVLSSPPDNWKGCKGRINKQMIKEYMPAPAGMDSKVLVCG
PDPMMESMVKILEEQGFKPPGKISKPQDEIFTFQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggagtttacagtctcgaggaggtgggcaagcacacttcaaagaccgatctg
tgggttgtcgtctggaaccatgtctatgatgtaacaaaataccaagaagaccatcccggt
ggtaaagagttcctgcttgagaacgcaggcgccgacgcaacaacggcatacgaagatatc
ggacattcgacagatgctagagagatactggagaacttccgcattggcaaagtcacggac
gatgattgggtcgaccatgagacgaagaagatgccagacgttaagccaaagaacgtccac
gtcgtcaacaatctccctcccccgaaaccacacaacctgcatttgccgcttgtagctgga
ggtctcgcaacgctgattgtgtccattgtacttggtcgacgattctccccggatctgcat
cactttcaaacgggcggtttctggaagggctttgctctgtcttcggttgccagtatggct
atagcaggatataccagtctctgggccacgaagaacttcaacgtcgcacacaaggacttc
caatcatatccagcacacgtcaaagccaagtcaacgtctgcaagaccttcgcagaagaaa
aacatcaatctgggagtactcaatgcccgtgaatatcaagagttcccactcaaagaaaag
ttcaacctttcacacgacactatccgtttcgtcttcagccttccaaatgagaactccgtc
ttggggctgccaactggccagcacatcgcaatcagacacgatgtggacggaaagcagctt
gcgcgatcatacacacccacgtccagcaacaaggatactggacgcttagaactgaccatc
aagatctacgaaggtggaaagctcactccttatttgagcaagctggaagtcggagacaag
gtcgagatcagaggaccaaagggtgaaatgaagtaccacaagaacctggtcaaagagctt
ggaatgattgccggtggtactggtattacgccaatgttccaaatcattcgccgcatctgc
gaagatccaagagacgacaccaagactacgctaatctacgcaaacaagaccgaggaggac
atcttgttaaagaaggagctggatgactttgcgcaaaagtacgaccagttcaagatccaa
tacgtcttgagcagcccaccagacaattggaaaggctgtaagggtcgcattaacaagcag
atgattaaggagtatatgccagcaccagctggtatggactcaaaggtgcttgtatgcgga
ccagatcctatgatggagagcatggtcaagatattggaagagcaagggttcaagccacct
ggcaagatttcgaaaccacaggatgagatttttaccttccagtaa

DBGET integrated database retrieval system