KEGG   Phaeosphaeria nodorum: SNOG_16550Help
Entry
SNOG_16550        CDS       T01161                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
pno  Phaeosphaeria nodorum
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:pno00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1084 aa AA seqDB search
MAAIASIISSFSLIFGGCCANVYCLEAIVKKEPDSGLLITLFQFVFTCLSTLHYQFDPNG
RYFLRSSPVPFRKWCVSATLFFTVNMLNNWAFAFNISVPVHIILRSFGSVTTMAAGWARG
KRYTRLQVFSVAILTAGVMVSAWADAQSKGKLANSSKVDMTSGSFEAGLVILLIAQLLSA
WMGAYVEDIYRDHGKDWQANLFYSHLLSIPMFAGFAPILYDQFTRLQSSESFSVPVSVAA
QLPPSLNKALASTSQHVIYLTANAVTQLLCITGVNILSANTSAVTVTIVLNIRKLVSFML
SIWIFGNQMGGLMKVGAGMVFGAGALYGWETSYRIPQQKKLESAKGKKGSLKIESTMSSP
GGQVRQRATKDKKRPTTPNPEALAEKVSEKVPHVLEKVKPYKPAQQGGEWDYKLAIAVMT
VLAFITRFWGIRHPDQVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFAGWLVGYKG
DFLFENIGDSYITNKVPYVAYRAMPASLGALTVPIVFMIMWESGYSLPACVTAAGLMLLD
NAHIGQTRLILLDASLIFFMALSVLSYIRFYKLRHEPFGRKWWKWLLLTGVNLSCVISIK
YVGVFTFFSVGVPVAIDLWDLMDVKRRQGALSLPEFGKHLAARVIGLIVVPFLLYLFWFQ
VHFSILSRSGPGDDFMTPEFQETLSDNMMTLQSVGIDYYDSITLRHKETKVYLHSHPDRY
PLRYDDGRVSSQGQQVTGYPHNDTNNHWQILPATTLPSEKEANGSRFNDTLFEIKVDKGK
GDFKTMSTHFKLVHVPTKVAMWTHTSPLPDWAYKQAEINGNKNIQQSSNVWYVDDIPSLP
AEDPRNKKEAKQVKRLSFLRKWVELQRAMFYHNNALTSSHPYASQPISWPFLLRGVSFWT
HNDTRQQIYFLGNPIGWWLASSLLAVFAGIIGADQLALRRGMDALDDRTRSRLYNSTGFF
FLTWAAHYIPFYIMGRQLFLHHYLPAHLASCLVTGALVEFIFCIEPMDVESPTIKGHRRT
QSRPVRERMATTSQMGSWIATGVILAATLWSFLFFAPLTYGSPGLDVAQVQARKWLGYDL
HFAK
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatcgcgtcgatcattagcagcttttcgctcatctttggcggctgttgcgca
aatgtatattgtctcgaggcgattgtaaagaaagaacccgacagcgggctgctcatcacg
ctgttccagtttgtctttacttgcttgtctacgttacactaccagtttgatcccaatggt
cgttatttcctcaggtcatcgcctgtgccattccgaaaatggtgcgtcagcgcgacgctg
ttcttcacggtcaatatgctgaacaactgggctttcgccttcaacatttccgtacctgtc
catatcattcttagaagttttggtagtgtgactacaatggctgctggatgggcacgtggc
aagcgatacactcgcttacaggtgttctctgttgcgatcctgactgcaggtgtaatggtg
tctgcttgggcggatgcacagtcgaagggtaaactcgcgaacagctcaaaggttgacatg
acaagtggctccttcgaggcaggccttgtcatcctgcttatcgcccagctcctttcggca
tggatgggggcctatgttgaggacatataccgcgaccatggcaaagattggcaagccaat
ctcttctactcacacctgctctcgatccccatgttcgccggctttgctcccatcctctac
gatcagttcactcgtctccaatcttctgagtcattctcggtcccggtcagcgtggcggca
cagctaccgccttctcttaacaaggctctcgcatcgacgtctcagcacgtcatctacctc
acggccaacgcagtcacgcaattactttgcattacaggtgtcaatattctcagcgccaat
acctctgcggtcactgtgacgatagtgttgaacattcgcaagctggtcagcttcatgttg
agcatctggatctttggcaatcagatgggcggactgatgaaggttggggctggtatggtg
tttggtgcaggcgcactgtatgggtgggagacttcgtaccgcattccgcaacagaagaaa
ctggagtcagcgaaaggtaaaaaaggcagcctcaagatagaatctacaatgtcatctccc
ggcggccaggtgaggcagcgcgcgaccaaggacaagaagcgcccgacgacaccaaacccc
gaggcgctcgccgagaaggtgtcggaaaaagtcccccatgtgctggaaaaggtaaagccc
tacaagccggcgcagcagggcggcgagtgggactacaagctggccatcgcggtcatgacg
gtgctggccttcataacccggttctggggcatcagacaccccgaccaggtcgtcttcgat
gaagtccactttggaaagtttgcttcgtactatctgcagcgaacctacttcttcgacgtg
cacccacccttcggaaagctgctcttcgccttcgccggctggctggtcggatacaagggc
gactttctctttgagaacattggcgactcgtacatcaccaacaaggtcccctatgtcgcc
taccgcgccatgcccgcctcgctcggcgccctcaccgtgcccatcgtcttcatgatcatg
tgggagtcgggatactcgctaccagcttgcgtcactgccgctggcctgatgctcctcgac
aacgcccacattggccagacgcgcctgatcctcctcgacgcttcgctcatcttcttcatg
gccctctccgtgctctcgtacattcgcttctacaagctgcggcacgagccctttggccgc
aagtggtggaaatggctgctgttgaccggtgtcaacctgagctgtgtcatctccatcaaa
tacgtcggtgtcttcactttcttctccgtcggtgttccggtcgcaatcgacctctgggac
cttatggacgtcaagcgccgccagggtgctctgtcgcttcccgagttcggcaagcacctc
gctgctcgtgtcatcggcttgatcgttgttccgttcctcctctaccttttctggttccaa
gtccacttctccatcctgtcccgctccgggccaggcgacgacttcatgaccccagagttc
caggagactctgagtgacaacatgatgactctccagtccgtcggaattgactactacgac
tccatcactttgcgccacaaggagaccaaggtgtacctccacagccacccggaccgttac
cctttgcgatatgacgatggccgtgtttcctcccagggacagcaggttaccggataccct
cataacgataccaacaaccactggcagattcttcccgccacgaccctgcccagcgagaag
gaggcgaacggctcacgcttcaacgacaccttattcgagatcaaggtggacaagggcaaa
ggcgacttcaagaccatgtctacccacttcaaactcgttcacgtgcccaccaaggttgcc
atgtggactcacacctcacctctgcctgactgggcttacaagcaggctgagatcaacgga
aacaagaacatccagcaatccagcaatgtctggtacgtcgacgacattccgtctctacca
gccgaggacccgcgcaacaagaaggaagccaagcaagtgaagaggctcagtttcctcagg
aagtgggttgagctccagcgcgccatgttctaccacaacaacgccctgaccagctctcat
ccatacgcttcgcagccaatttcctggccgttccttctccgcggtgtttccttctggacc
cataacgacacccgccagcagatctatttcctgggtaaccccatcggatggtggttggcc
tcatccctgcttgccgtcttcgctggcatcattggcgctgaccagctggctctccgccgt
ggcatggacgctctcgatgaccgcactcgttctcgtctatacaactctaccggcttcttc
ttcctgacatgggcagctcattacattcccttctacatcatgggtcgtcagctcttcctg
caccactatcttcctgcccatctcgcctcgtgtcttgtcacaggcgcactggttgagttc
atcttctgtatagagcctatggatgttgagtcgcctaccatcaagggccaccgccgcaca
cagtcacgtcctgtccgcgagcgtatggctactaccagccaaatgggtagctggatcgcc
accggtgttatccttgccgccactctctggagtttcctcttctttgcgccgcttacatac
ggctcgcccggtcttgatgtggcacaggtgcaagcgaggaaatggctcggatacgatctg
cattttgccaaataa

DBGET integrated database retrieval system