KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0083Help
Entry
Pnuc_0083         CDS       T00502                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pnuc_0083
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pnuc_0083
Exosome [BR:pnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnuc_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(77418..78443)
Genome map
AA seq 341 aa AA seqDB search
MKTKSPANSLLNFPAHRPRRMRRDDWSRRLMQENSVSASDLIYPVFLLEGSGQSQAVASM
PGVNRVSLDLLIPVAQECVDLGIPVLALFPVIDAALKTADGKEAFNANGLIPTAVRELKK
RFPNLGIMTDVALDPYTSHGQDGVLDDQGRILNDETTAILVQQAIAQAQAGVDIVAPSDM
MDGRIGKIREALEQKNLIHTRIMAYSAKYASAFYGPFRDAVGSSKNLGKADKKTYQMDCA
NGDEALREVALDISEGADMVMVKPGMPYLDIVRRVREEFDYPTYAYQVSGEYAMLKAAAQ
NGWLDHDAVMMESLIAFKRAGADGVLTYFALDAARLIRSNS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaaatcaccagctaattctttattgaacttcccggctcaccgccctcgccgt
atgcgccgagatgattggtctcgtcgcctgatgcaagaaaacagtgtgtctgcaagcgat
cttatttatccagtatttctactggaagggtccgggcaatcgcaagctgttgcctctatg
ccaggagtcaatcgcgtttccttagatctattaattccagttgctcaagaatgtgttgat
ttgggcataccagtattggcacttttccctgtgattgatgctgccttaaaaacagctgat
ggcaaagaagcttttaacgcaaatggcctcattccaactgctgttcgagagctcaaaaaa
cgattccccaatttaggcatcatgaccgatgtcgcgctcgatccctacaccagccatggc
caagatggagtactggatgatcaaggtcgcattttgaatgatgagacgaccgctattttg
gttcaacaagcaattgctcaagcgcaagctggtgtcgacatcgttgcaccctcagacatg
atggatggtcgcattggaaaaattcgtgaggcccttgaacaaaagaatttaattcacact
cgcatcatggcttattcagctaaatatgcctccgcgttttatggtccatttcgtgatgca
gtagggtcttccaaaaatttaggtaaggcagataaaaaaacgtatcaaatggattgtgct
aacggcgatgaagccttgcgtgaagtagcgctcgatatcagcgaaggtgccgatatggtg
atggtcaagccgggtatgccttatttagatatcgtacgtagagtgagggaagagtttgat
taccccacttatgcctaccaagtcagcggtgaatacgccatgcttaaagctgccgcacaa
aatgggtggcttgatcacgatgcagtcatgatggaatctctaatcgcctttaaacgcgca
ggggctgatggcgttttgacctactttgctctagatgcagccagattaattcggtcaaat
agctag

DBGET integrated database retrieval system