KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_0105Help
Entry
Pnuc_0105         CDS       T00502                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pnu00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pnu00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
100781..102055
Genome map
AA seq 424 aa AA seqDB search
MDKLRMTGGTPLNGEVTIAGAKNAALPILCACLLTDQPVVLRNLPDLQDVRTMLKLLQEI
GVVVSFPDANNPNHVILNAAVIKSSEATYEMVKTMRASILVLGPLLARMHSAKVSLPGGC
AIGARPVDQHIKGLKAMGASIKIKSGYIQAETKPTTERLKGASILTDMITVTGTENLLMA
ATLASGTTILENAAREPEVGDLAELLVKMGAKITGIGSDRLVIEGVEKLHGAEHSVIPDR
IEAGTFLCAVAAAGGEVLVKHCRPDTLDAVIVKLKEAGLKMEIGPDWIKASMQGRPKAVS
FRTSEYPAFPTDMQAQLMAVNAVANGNSTITETIFENRFMHVQELNRLGADIAIEGNTAI
AQGVERLSGAIVMATDLRASASLVIAGLAAQGETQVDRIYHLDRGYDRMEQKLTRLGANI
ERIK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataaattaagaatgactggcggtaccccgctcaatggcgaggtgacgattgcaggc
gcaaagaatgctgcgctaccaattttgtgtgcctgtctcttaactgaccaaccagtcgtg
ttacgtaatttacctgatcttcaagatgtccgaaccatgctcaagttattgcaagagatt
ggtgtggtcgttagttttccagatgcgaataatcctaaccatgtgatcttaaatgcggct
gtgatcaagagttctgaggcaacttatgaaatggtgaaaactatgcgtgcatcgatcttg
gtgcttggtcctttgctcgccagaatgcatagcgccaaagtgtcattgccgggtgggtgt
gccattggtgctcgacctgtcgatcagcatattaagggcctcaaggccatgggtgcgagc
atcaaaattaagagtggttacattcaggctgaaaccaagccgacaacggaacgactcaag
ggcgcctcaattctgactgacatgattactgtgacggggactgaaaatttattaatggcg
gcgaccttggcttcgggtacaactattttagaaaatgcagcacgtgagccagaggttggt
gatctcgctgaattactcgttaagatgggcgcaaagattacgggtattggcagtgaccgt
ttggtaattgagggtgttgaaaaactccatggagctgaacattcagtcattccggaccga
attgaagcaggtacttttttatgcgcagttgctgctgcaggtggagaagtattggtgaag
cattgccgcccggatacgcttgacgcggttatcgtcaagttaaaagaagcaggcttgaag
atggagatagggccggattggattaaggcgtctatgcagggtcgtccgaaagcagtgagc
tttcgtacttcggaatatccagccttccccacagatatgcaggcacagctcatggctgta
aatgcagtagcaaacggtaattcgacaattacggaaacaatttttgaaaatcgctttatg
cacgttcaagaattaaatcgcttgggtgctgatattgcgattgagggtaatactgcaatt
gcgcagggagtagagaggctttctggagccattgtgatggctacggatttacgcgcttca
gccagcttggtgattgctggccttgctgcccaaggtgaaacccaggtggaccgtatctat
catttagatcgaggttacgaccgtatggagcagaagttaacccgcttaggcgccaacatt
gagcgtattaagtag

DBGET integrated database retrieval system