KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0107Help
Entry
Pnuc_0107         CDS       T00502                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnuc_0107
  Amino acid metabolism
   00340 Histidine metabolism
    Pnuc_0107
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pnuc_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
102737..104059
Genome map
AA seq 440 aa AA seqDB search
MPKPVQVKRLNSQDIGFIETLLSSLSLPMADDEAIDAAVVKILTAVKAKGDAAVLEFTKQ
FDRLNVAKVSELEITRPELERAYNELSAVQKNALDVAAQRVRAYHEKQKIEAGCHSWEYE
EADGTRLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAKVAGVAEVIMVVPTPDGSRNP
LVLAAAYLAGVDRVFTIGGAQAVAALAYGTETIPSVDKIVGPGNAYVAAAKRRVFGTVGI
DMIAGPSEILVLCDGSSNPDWVAMDLFSQAEHDEQAQSILLCPDAKFIEQVQDSINRLLP
EMPRAKVIEASLTNRALFIQVQDMKQACEIANAIAAEHLEICTVDPRQWADQIRHAGAIF
MGNYTSESLGDYCAGPNHVLPTARTARFSSPLGVYDFIKRSSMIEVSEAGAQTLGAIAST
LAHGEGLQAHARAAEMRLKK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaccagtacaagtaaagcgcctcaacagccaagatataggtttcatagaaacc
ttactctctagcctttctttgcctatggcagatgatgaggctatagacgccgcggtagtc
aagattttgactgccgtgaaagcgaaaggtgatgccgctgttttggaatttactaaacag
tttgatcgcctaaatgtagccaaggtttcagaattagagatcactcgcccggaattagaa
cgtgcctacaacgaactttctgctgtgcaaaaaaatgctttagatgttgcggctcaaaga
gtgcgcgcttatcacgagaagcaaaaaattgaagcgggttgtcattcttgggaatatgaa
gaggctgatggcacgcgtttgggtcaaaaagtaacgccactggatcgcgttggtatttat
gttcctggtggcaaggctgcctacccatcctctgtcttgatgaatgcgattcctgcaaaa
gttgctggagttgccgaagtcattatggtggtccccacgccagatgggtcacgtaatcct
ttggtcttggccgctgcctatttggctggcgtggatagagtatttactattgggggcgct
caagcagtagcggctcttgcttacggcactgaaacgattccatcggtagataaaattgtc
ggtccaggtaatgcttacgtagccgcagccaagcgcagagtctttgggactgtgggaatt
gatatgattgccggcccatcagagatattggttttgtgtgatggatctagtaaccctgat
tgggttgctatggatttattttctcaagcagagcatgacgagcaagcacaatctattttg
ctatgccctgatgcgaagtttatcgaacaagttcaagatagcattaatcgattgcttcct
gaaatgccaagggcaaaagtgattgaggcttccttaacaaatcgcgctctattcattcaa
gtgcaggatatgaagcaagcatgtgaaattgccaatgcgatagctgctgagcacttggaa
atttgcactgtcgatccgcgtcagtgggctgatcagattcgtcatgctggggctatcttt
atgggtaactacaccagtgaatcgctaggcgattattgtgctggacctaatcacgtatta
ccaacagcacgcactgcgcgtttctcatctccgctgggtgtttacgacttcatcaagcgc
tcaagcatgattgaagtgagcgaagctggggcacaaaccttaggggctattgctagcacc
ttggctcatggggaaggtttgcaagcccatgctcgtgcagctgagatgcgtcttaagaag
taa

DBGET integrated database retrieval system