KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0140Help
Entry
Pnuc_0140         CDS       T00502                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Brite
Enzymes [BR:pnu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pnuc_0140
Secretion system [BR:pnu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pnuc_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(134779..135492)
Genome map
AA seq 237 aa AA seqDB search
MIKFLSAVLICVGLICSTSVQAQAEQQIKVDIQKKLGTTVKVKSVHPAPISGLYEVLVGN
DIFYTDASGKYLFQGEIIELATGKNITEQRQNDLNRIKWSDLNQSNAFKTVRGNGSRQLA
IFSDPNCGYCKRLEKSLQQLDNITIYTYLIPILSPDSAQKAKQIWCSADPSKTYIDWMVN
GVTPNGKSDCTTPLDKNLAFAKTYGITGTPTLFFIDGSRFPGAVQITDIEKKFGSLK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaatttttatcagcagtactaatatgcgtaggtctcatatgctcgacatccgtt
caagcacaagctgaacagcaaattaaggtcgatattcaaaaaaaattgggcactactgtc
aaggtaaaaagtgttcatcctgcacccatttcaggcctctatgaagtgttggttggaaat
gacattttttataccgacgcctctggaaaatatttattccaaggtgaaatcattgagctc
gctactggtaaaaacattacagagcagcgtcaaaatgaccttaatcgcattaaatggtct
gatttaaaccaatctaacgcctttaaaacagttcgaggcaacggcagtcgacagctggca
attttttctgaccctaattgcggttactgcaagcgccttgagaaatctttacagcagcta
gataacatcaccatctatacgtatctcatacccattctttcgcctgactccgctcaaaaa
gcaaagcaaatctggtgctctgctgacccgtcgaagacgtatatcgattggatggtcaat
ggagttaccccaaatggaaaaagtgattgcacaacacccttagataagaatctggcattt
gcaaagacttacggcattactggtacccctacactcttttttattgatggcagtcgcttt
ccaggcgcagtacaaattactgacatcgaaaagaaattcggctcacttaaataa

DBGET integrated database retrieval system