KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_0197Help
Entry
Pnuc_0197         CDS       T00502                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pnu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pnu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
192986..193768
Genome map
AA seq 260 aa AA seqDB search
MDLKQKKRIVVKVGSSLVTNNGEGLDHAAIALWAEQIATLLQAGHEVLMVSSGAIAEGMQ
RLGWAKRPQDIHQLQAAAAVGQMGLVQVYESCFARFNLRSAQILLTNADLAHPERNANAK
VTLDTLLKLGVVPIINENDTVVTDEIKFGDNDSLAALVTNLVHADLLVILTDQGGLFTAD
PRQNPDATLLATATAGDPALEKMAGGAASELSKGGMLTKVLAAKIAVQTGASTVIASGHE
PKVLTRLLNGESIGTLLSSQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggatcttaagcaaaaaaaacgtattgttgtcaaagtaggttctagcctcgttactaat
aatggcgagggcttagatcatgctgccatagctttatgggccgagcaaattgccacgctt
ttgcaagctggccacgaagtgttgatggtcagttcgggcgcaattgctgagggcatgcaa
cgtttgggttgggctaaacgtccccaagacattcaccaactacaagctgccgcagctgtt
ggtcagatgggcttggtacaggtttatgaaagctgttttgctcgctttaatttacgcagt
gcgcagatattattgactaatgctgacttggctcatccagagcgcaatgcaaatgcaaaa
gtaaccttagataccttgctcaagcttggtgtggtccccattattaatgagaacgacaca
gtagtaaccgatgaaattaaatttggtgataatgatagtctggcagcgctcgtcacaaac
ttagtgcatgcagatctattggttatcttgacggatcaaggcggtctatttaccgctgat
cctcgtcaaaacccagatgcaactttattggctacagcaacagcaggagatcctgcttta
gagaagatggctggcggtgctgctagtgaattgagtaagggcggtatgctcaccaaagta
ttggctgcaaaaatcgccgtgcaaacaggagcatccactgttattgcctctggacatgag
cctaaggtactcactcgcttattaaatggcgagagtattggtaccttacttagtagccaa
taa

DBGET integrated database retrieval system