KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_0246Help
Entry
Pnuc_0246         CDS       T00502                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pnu00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pnu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
244854..245834
Genome map
AA seq 326 aa AA seqDB search
MSSENNAGANLVNQFNAAGELTHLLTLEGLPKEQILHILDTAQQFVSVTDPSREVKKVPL
LRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLDISTSSTAKGESLLDTIDNLVAMQA
DIFVVRHSVSRAPIEIANHVPTHVHVVNAGDGSHQHPTQGLLDMYTMRHFKQNFKGLKVA
IVGDIVHSRVAKSNIHALTTLGCEDIRVIGPESLLPSDLDMLGVKVYHSMEEGLKDVDVV
MTLRIQKERMEAGQVPEGDAFFNQYGLTPTRLALAKSDAIVMHPGPMNRGVEIDSVVADG
PQSVILNQVTFGIAVRMAVMSIVAGN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagctcagaaaacaatgccggcgctaacttggtgaatcaatttaatgcagccggggag
ttgacccatctgctgactctagaaggactaccaaaagagcaaattttgcatattttggat
actgcccagcagttcgtcagtgttactgatccatctcgtgaggttaaaaaagttcccctg
ctgcgtggaaaaagtgtttttaatcttttttttgaaaactctacgcgcactagaactaca
ttcgagattgcagcaaaacgcttatcggcagatgtgattaatttagatatttctacatcc
tcaactgcgaaaggtgaaagtcttctcgacacgattgataacttagtagcaatgcaggcc
gatatttttgtagtgcgtcatagtgtttcgcgtgcgcccattgaaattgccaatcatgta
cctactcatgtacacgtagtgaatgcgggcgatggtagtcatcagcatccaacacagggt
ttgttggatatgtatacgatgcgccactttaagcaaaatttcaaaggcctcaaagtcgct
atcgttggtgatattgttcatagccgtgttgccaagtcgaacattcatgccctgactact
ttaggttgtgaagatattcgtgtgatcggtcctgaaagcttgttgccaagcgatctcgac
atgctgggggttaaggtgtatcacagcatggaagaaggcttaaaagacgtagacgttgtg
atgacgctgcgtattcagaaggagcgcatggaggcaggccaagtgcccgaaggggatgcg
ttctttaatcaatatggattgacaccgacgcgcttagcattggcaaagtctgatgcaatc
gtgatgcatcctggcccaatgaatcgtggcgtagaaattgattccgttgttgcagatgga
cctcaatcagtcatcttgaatcaggtgacatttggcattgcagttcgtatggcagtgatg
tcaatcgttgctggtaattaa

DBGET integrated database retrieval system