KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_0295Help
Entry
Pnuc_0295         CDS       T00502                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pnu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
286648..287436
Genome map
AA seq 262 aa AA seqDB search
MVTKNTKTPAKTQTKAVAKKLSVKKMTPQKIQSKNDDAGLPLSVMIRRRIEAQNARFHAN
DNISAFIKPGELEGLVDEVAEKMQAVLESLVIDTNSDHNTKNTSRRVAKMYVQEVFNGRY
VEQPTLTKFPNVSRLNELMIVGPITIRSACSHHLCPIMGRIWIGVLPSKESALIGLSKYS
RLTEWVMCRPQIQEEAVVELADMLEKKIKPIGVAIVMDADHFCMQWRGVKDRDSKMVNSV
MRGAFLKDSNLRREFLSLLDKR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggttacgaaaaataccaaaacaccagcaaagacacaaactaaggctgtagcaaaaaaa
ttgagcgttaaaaagatgactcctcaaaaaatacaaagtaaaaatgacgatgctggcttg
ccgctatcggtaatgattcgtcgccgtatcgaagcgcaaaatgcacgctttcatgcgaac
gataatatttccgcttttattaaacccggtgaactagagggcttggtagatgaggttgct
gaaaaaatgcaagccgtacttgagagcctggtgattgataccaatagcgatcacaacacc
aagaacaccagtcgtcgtgtggctaagatgtatgtacaagaggtctttaatggtcgttat
gtagagcagccaacccttaccaagtttccaaatgtcagccgtttaaacgaattgatgatc
gtaggacctattacgattagaagcgcctgctctcatcacctttgccccatcatgggtcgt
atttggattggggtattaccaagcaaagagtccgctttaattggtttatctaaatattca
cgattgactgagtgggtgatgtgtagaccacagattcaagaagaggctgtagttgagttg
gctgacatgctagagaaaaaaattaaaccgattggggttgccatcgtgatggatgccgat
cacttttgcatgcaatggcgtggcgtcaaagatcgcgactctaagatggtaaacagtgtg
atgcgcggcgcattcttaaaagactctaacttgcgtcgtgagtttttatctctattggat
aagcgctaa

DBGET integrated database retrieval system