KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0295Help
Entry
Pnuc_0295         CDS       T00502                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pnuc_0295
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pnuc_0295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
286648..287436
Genome map
AA seq 262 aa AA seqDB search
MVTKNTKTPAKTQTKAVAKKLSVKKMTPQKIQSKNDDAGLPLSVMIRRRIEAQNARFHAN
DNISAFIKPGELEGLVDEVAEKMQAVLESLVIDTNSDHNTKNTSRRVAKMYVQEVFNGRY
VEQPTLTKFPNVSRLNELMIVGPITIRSACSHHLCPIMGRIWIGVLPSKESALIGLSKYS
RLTEWVMCRPQIQEEAVVELADMLEKKIKPIGVAIVMDADHFCMQWRGVKDRDSKMVNSV
MRGAFLKDSNLRREFLSLLDKR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggttacgaaaaataccaaaacaccagcaaagacacaaactaaggctgtagcaaaaaaa
ttgagcgttaaaaagatgactcctcaaaaaatacaaagtaaaaatgacgatgctggcttg
ccgctatcggtaatgattcgtcgccgtatcgaagcgcaaaatgcacgctttcatgcgaac
gataatatttccgcttttattaaacccggtgaactagagggcttggtagatgaggttgct
gaaaaaatgcaagccgtacttgagagcctggtgattgataccaatagcgatcacaacacc
aagaacaccagtcgtcgtgtggctaagatgtatgtacaagaggtctttaatggtcgttat
gtagagcagccaacccttaccaagtttccaaatgtcagccgtttaaacgaattgatgatc
gtaggacctattacgattagaagcgcctgctctcatcacctttgccccatcatgggtcgt
atttggattggggtattaccaagcaaagagtccgctttaattggtttatctaaatattca
cgattgactgagtgggtgatgtgtagaccacagattcaagaagaggctgtagttgagttg
gctgacatgctagagaaaaaaattaaaccgattggggttgccatcgtgatggatgccgat
cacttttgcatgcaatggcgtggcgtcaaagatcgcgactctaagatggtaaacagtgtg
atgcgcggcgcattcttaaaagactctaacttgcgtcgtgagtttttatctctattggat
aagcgctaa

DBGET integrated database retrieval system