KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0437Help
Entry
Pnuc_0437         CDS       T00502                                 

Definition
(GenBank) aminotransferase (EC:2.6.1.-)
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Pnuc_0437
   01230 Biosynthesis of amino acids
    Pnuc_0437
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pnuc_0437
   00290 Valine, leucine and isoleucine biosynthesis
    Pnuc_0437
   00220 Arginine biosynthesis
    Pnuc_0437
Enzymes [BR:pnu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Pnuc_0437
    2.6.1.66  valine---pyruvate transaminase
     Pnuc_0437
Amino acid related enzymes [BR:pnu01007]
 Aminotransferase (transaminase)
  Class I
   Pnuc_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
426111..427367
Genome map
AA seq 418 aa AA seqDB search
MKPILKSQKLNDVCYDIRGPVLELAQRMEEEGHKIIKLNIGNVGVFGFDPPEEIQLDMIR
NLSNASAYSDSKGIFSARKAIMQYCQEKGIQGVTLDDVYTGNGVSELIVLSMNALLNDGD
EVLVPAPDYPLWTAAVSLSGGTPVHYLCDESKEWAPDLADLRKKITPSTKAIVVINPNNP
TGAIYSKEVLVELTQIARENGLILFADEIYDKMLYDGEKHLSLASLSTDVVIITFNGLSK
NYRSCGYRAGWMVVSGDKEMVRDYIEGLNMLCSMRLCANVPGQYAIQTALGGYQSINDLV
NEGGRLARQRDLAWKLITEIPGVSCVKPKSALYLFPKLDPEIYPIEDDQQFVADLLKDEK
VLLVQGSGFNWGKPDHFRVVFLPHEDVLKEAIGRLARFLERYRQKHGRKASSTATKAS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacccatcctaaagtcccaaaaactgaatgatgtctgctacgacattcgcgggccg
gtgctcgagctcgctcagcgtatggaggaagagggtcataagatcatcaaattaaacatc
ggaaacgtaggggtttttggcttcgatcctcctgaagaaattcagttggacatgatccgt
aacctgagtaacgcttctgcttattctgattccaaagggatcttttccgctcgtaaggca
atcatgcagtattgccaggaaaaagggattcagggcgtcactttagatgatgtctatacc
ggtaacggcgtttctgaactcatcgtgctgtcgatgaatgctttattaaatgacggcgat
gaagtgttggtaccagcgcctgattatccattgtggaccgccgccgtcagtttgtctggc
ggtactccagtgcattatctttgtgatgaatctaaagagtgggctcctgacttagctgat
cttcgtaaaaaaattacgccaagtacaaaagcgatcgtggtgattaatccgaataatccg
accggcgcaatttattccaaagaagtgttggtggagttaacgcagatagctcgtgaaaac
ggtttgattttatttgccgacgaaatttacgacaagatgttgtacgacggtgaaaaacat
ctttccttggcatcgttgtctaccgatgtagtcatcattacttttaatggcctctccaaa
aattaccgttcatgcggctaccgtgctggttggatggtggtttcgggtgataaagagatg
gtgagggactacattgaaggccttaatatgctctgctcaatgcgcctatgcgccaacgtt
ccagggcaatacgctattcaaactgcgcttggcggctatcaaagtattaatgacttagtt
aacgaaggtggacgcttagcaagacaacgcgatcttgcgtggaaattgattactgaaatt
cctggcgtgagttgcgttaagccaaaatctgctttgtatttgtttcctaaattagatcca
gagatttatcccatcgaggatgatcaacagttcgtcgccgatcttttaaaggatgaaaaa
gtattgttagtgcaaggctcaggttttaattggggcaaaccggatcatttccgcgtagtc
ttcttgcctcatgaggatgtgttgaaggaggcgattggccgccttgcacgttttctcgag
cgctatcgtcaaaagcatggccgtaaggcttcttcaactgcaacaaaggcatcatga

DBGET integrated database retrieval system