KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0439Help
Entry
Pnuc_0439         CDS       T00502                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnuc_0439
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnuc_0439
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pnuc_0439
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pnuc_0439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
428683..430125
Genome map
AA seq 480 aa AA seqDB search
MRYQSTRGNSPQQSFLEILLGGLAPDGGLYLPTEYPQVTLAQLNSWRGLSYADLAYEVLS
LYCDDIPEADLRALLRKTYTEQVYCNGRSQDNAKDITPLHWLGEEHGTKIGLLSLSNGPT
LAFKDMAMQLLGNLFEYALKRAGQKLNILGATSGDTGSAAEYAMRGKEGVRVFMLSPRGK
MSSFQSAQMYSLQDPNIFNLAVAGVFDDCQDIVKAVSNDHAFKAQSQIGTVNSINWGRVV
AQVVYYFQGYLLATKSSKEKVSFTVPSGNFGNVCAGHIARMMGLPIEHLIVATNENDVLD
EFFRTGVYRARKSAETLQTSSPSMDISKASNFERFVFDFMGKDGKATAGMFKQVDETGGF
DISQDKVFKELGKYGFQSGRSTHQNRLETIRDIDQKYGVMIDTHTADGVKVAREHLQAGI
PMLVLETALPIKFEETIQEALGRPAECPPAFRDIKSHPQRVENIDADVNQVKAFITAHLN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgttaccaatctactcgtggcaacagcccacaacaatcctttctagaaattctgttg
gggggattggcgcctgatggcggtttgtacctgccaactgagtacccgcaagtcactcta
gcgcaactaaattcttggcgcggtttgtcatacgctgatcttgcctatgaagtgctcagt
ttgtattgcgacgatattcctgaggctgatttgcgtgctttattgcgcaagacctataca
gagcaagtctattgcaacggtcgttctcaagataatgctaaagacatcacccccttgcat
tggctgggtgaagagcatggcacgaagattggtctattgagtctttctaacgggcccact
ttggcgttcaaggatatggcaatgcagttattgggcaatctttttgaatatgctctaaag
cgtgctggccaaaaactcaatatcttgggtgcgacttccggcgacactggtagtgcagca
gagtatgcaatgcgtggcaaagagggtgtaagggtatttatgctttcacctcgcggcaag
atgagctcgttccaatctgcacaaatgtattccttgcaagatcccaatatttttaattta
gcagtggccggtgtctttgatgattgccaagacatcgtgaaagcagtgagtaatgaccat
gcgtttaaagctcagagccaaattggtactgtcaactcgattaactggggtcgtgttgtt
gcccaagtggtgtattacttccaaggttacttattagccacgaaatctagcaaggaaaaa
gtttctttcacggtgccgtctggtaactttggaaatgtatgtgctggtcatatcgcacgc
atgatgggtctacctattgagcatctgattgtggcaaccaatgagaatgatgtgttggat
gaatttttccgcaccggggtttaccgtgcgcgcaaatcagccgagactctgcaaacctct
agtccttccatggatatttccaaggcaagtaactttgagcgctttgtatttgacttcatg
ggtaaagacggtaaagctacagcagggatgtttaagcaagtggatgagaccggtggcttt
gatatctctcaagataaggtattcaaagagcttggtaagtatggtttccaatctggacgc
agcacccatcaaaatcgtttagagactattcgcgatatcgatcagaaatatggtgtgatg
attgatacacatactgccgatggcgtaaaggttgctcgcgaacatttgcaggccggtatc
ccgatgctcgttttggaaactgcgctaccaattaagtttgaagaaacgattcaagaagcc
ttgggtcgtccagccgagtgcccaccagcatttcgtgatatcaagtcgcacccacagcgt
gtcgaaaatattgatgcagatgtaaatcaggtcaaagcatttattactgcgcacctcaac
tga

DBGET integrated database retrieval system