KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_0624Help
Entry
Pnuc_0624         CDS       T00502                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pnu00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pnu00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pnu03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pnu03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pnu03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
613949..614416
Genome map
AA seq 155 aa AA seqDB search
MARIDFHSNVGDKLEYVCRLIRKIWSATAEGHPVRQIVIVGDKGDLQKLDSLLWTFSTTD
FLPHCSINHEAAAETPIVLADDFASTAFSQIPHADVLIHIGVKMPPDVLGLVERFPRIVE
VVTVNEAERLAGRERFKAYRALGHELHNFDQSKSA
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctcggattgattttcatagcaatgttggcgataagctggaatacgtttgtcgcctc
attcgaaaaatttggagcgctactgccgagggacatccagttcgacaaatagtgatcgta
ggcgataaaggtgatttgcaaaagctagatagcttgctatggacttttagtactactgac
tttttgccacactgctctatcaatcatgaggctgcagcagaaactcccattgttcttgct
gatgactttgcgtctactgcctttagtcaaattcctcacgctgatgtcctgatccatatt
ggtgtgaagatgccacccgatgttctggggttggtcgagcgtttcccgcgcattgtcgag
gtagttacggttaatgaagcggagcgtctggctgggcgagagcgattcaaggcttaccgg
gctttgggccatgagcttcataattttgaccaatccaaaagtgcttaa

DBGET integrated database retrieval system