KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0657Help
Entry
Pnuc_0657         CDS       T00502                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pnuc_0657
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pnuc_0657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
648502..649326
Genome map
AA seq 274 aa AA seqDB search
MSTKTIVITRPTGQARQLIEVLTKVIEASAIAKRSLPELVSLPLLTIVPKSDEHLADSIA
STLQDADLAIFVSPNAVESVMRLLERDWQDFSKRIIPIGVMGGSSRLALKNHGIGQEDYP
TSIYMPSINERWDSEGLWQELQTLDWDWTHKKVVIFKGDGGREWLADTLQKAGATVEAIS
TYTRVPLDIDNPAWQVIHEMDFSKSLWLLTSSEAVRYLGEVIRDQFPYGLESASALCPHH
NIADAAEAIGFGEVFTSEPGDEALIKTTLAWLTI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaagactattgtcattactcgaccaaccgggcaagctcgacaattaattgaa
gtgctcacaaaagtaattgaggctagtgcgatagccaagcgtagcctacccgaactagtg
tctttacctttattgaccatcgttcccaagagtgacgagcatctcgcagactctattgcc
agcacgcttcaagatgccgacctagctatttttgttagccctaatgccgttgaaagcgtg
atgcgtttactggagcgggattggcaggatttttccaagcgaatcattcctattggcgtg
atgggcggaagcagtcgtttggctttaaaaaatcatggcatcggtcaagaggactatcca
acttctatatatatgcccagcattaatgagcgctgggattcagaaggtttatggcaagag
ttacaaactctggattgggattggactcataaaaaagtagtgatttttaagggcgatggt
ggcagagagtggttagcggatactctgcagaaagcgggcgcaacagtcgaagccatatcc
acctacacccgggttcccttagatattgataatcctgcgtggcaagtgattcacgaaatg
gatttttcaaaatcgctttggttgcttacttcttcagaagcggtgcgctatttaggggaa
gtcattcgcgatcaattcccttacggtttagaaagcgcgagcgccttatgcccacatcac
aatattgctgatgcggcagaggcgattggttttggggaggtatttacttcagagccaggt
gatgaggcactcattaaaaccactttagcgtggctcactatttag

DBGET integrated database retrieval system