KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0702Help
Entry
Pnuc_0702         CDS       T00502                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pnuc_0702 (recR)
DNA repair and recombination proteins [BR:pnu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pnuc_0702 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
702197..702811
Genome map
AA seq 204 aa AA seqDB search
MARVEAPQDALGRLIEALRVLPGVGPKSAQRMAFYLLQHDRNGAAVLAQSLGEAVDTVGH
CARCNTFSETQICSTCADGRRDPSLLCIVETPADQVMVEQTLSFKGNYFVLMGRISPLDG
MGPNEIHFDRLLTRIENPDTGVPIREVVLATNFTSEGEATAHYIGEVLKAKGIKVTRIAR
GIPVGGELEYVDAGTLARALMDRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgttgaagcacctcaagatgctcttggtcgtttgatcgaggcattgcgcgta
ttgcctggcgtaggccccaagtctgcgcaacgcatggcattttatttattgcagcatgat
cgcaatggtgccgcagtcttagcgcaatcattgggtgaggccgtagatacagtagggcat
tgcgcccgttgcaatactttttcagaaactcaaatctgtagcacttgtgccgatgggcgg
cgggatccttctttgctctgtattgtggaaacaccagcagaccaagtgatggtcgagcaa
acactgagctttaaaggcaactattttgtattgatgggtcgcatctcgccactcgatggt
atgggtccgaatgaaattcattttgatcgtttgctcacgcgtattgaaaatcctgatact
ggagttcccattcgggaggtggtcttagcgaccaacttcactagcgaaggcgaggctact
gcccattacattggcgaagtactgaaagcgaagggcatcaaagtaactcgcatcgctaga
ggcattccagtgggcggcgagttggagtatgttgatgcgggtacacttgctcgcgcctta
atggatcgacgctag

DBGET integrated database retrieval system