KEGG   Polynucleobacter asymbioticus: Pnuc_0735Help
Entry
Pnuc_0735         CDS       T00502                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00010  Glycolysis / Gluconeogenesis
pnu00020  Citrate cycle (TCA cycle)
pnu00620  Pyruvate metabolism
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01120  Microbial metabolism in diverse environments
pnu01130  Biosynthesis of antibiotics
pnu01200  Carbon metabolism
Module
pnu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnuc_0735
   00020 Citrate cycle (TCA cycle)
    Pnuc_0735
   00620 Pyruvate metabolism
    Pnuc_0735
Enzymes [BR:pnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pnuc_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABP33953
JGI: Pnuc0735
UniProt: A4SWT9
Position
737188..738792
Genome map
AA seq 534 aa AA seqDB search
MSQIIEIKVPDIGDYKDVPVIEVLVKPGDQVEKEQSIVVLESDKATMDVPSSHSGIVKEV
KVKVGDNLSEGSVVIMLEEGAAAAAPTPTASAPAPVAVEASSGGAPIEIKVPDIGDYKDV
PVIEVLVKAGDKVEKEQSIVVLESDKATMDVPSSHAGIVKEVKVKVGDNLSEGSVVVILE
GGSAVATPPAVSSAAPAPAATKAVAVEPPIARAPAPPPVSNTPAPIDAALSHASPSVRKF
ARELGVTITQVKGSGPKGRITQEDVQAFVKAAMSGGAGNPAAAPSGDSLGGLNIIPWPKV
DFAKFGEIERQPLNRIKKLTAANLGRNWIMIPAVTYHEDADITDLEAFRVLTNKENEKKG
VKITMLAFLMKAAVAALKKYPEFNSSLDGDDLILKKYFNIGFAADTPTGLVVPVIKDVDK
KGIFDLAKETSDLAALARDGKLKPEQMQGASFTISSLGGIGGTYFSPIVNAPEVAILGVS
KAAMKPVWDGKQFVPRLICPLSLSADHRVIDGALATRFNVYIAQLLADFRRASL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaataatcgaaattaaagttcccgatattggtgattacaaagacgttccagtc
attgaagttctggttaagcctggtgatcaagtagagaaagagcaatctattgttgttctt
gagtccgataaagccacgatggatgttccttcttctcactctggaattgtgaaagaagtg
aaggtcaaggttggcgataacctttctgagggatcggttgtgatcatgttggaggagggc
gctgctgcagccgcaccaactccaacagcaagtgcgccagcacccgttgcggtcgaggct
agttcgggcggagcgccaatcgaaattaaagttcccgatatcggtgattacaaagacgtt
ccagtcattgaagttctggttaaggctggtgacaaagttgaaaaagaacaatccattgtt
gttctagaatctgataaagcaacgatggatgttccttcttctcacgctggaattgtgaaa
gaagtgaaggtcaaagttggcgacaacctttctgaggggtcggttgtagtgatcttagag
ggaggctctgcagttgctactccaccagcagtgtcttctgcagctcctgctcctgctgcg
actaaagcggtagcagtagagccgccaattgctcgggctccggcacctcctccggtgagc
aatacgccggctccaatagatgccgcattgagtcacgccagtccttctgttcgtaagttc
gctcgcgaactcggtgtcactatcacccaggtaaaaggatctggtcctaaaggccgcatt
actcaggaagacgtccaggcatttgttaaagcggctatgagtggtggcgctggtaatcct
gctgctgcacccagtggtgatagtttgggtggactcaatattattccttggcctaaagtt
gatttcgctaagtttggtgagatcgagcgtcaaccattaaatcgcattaagaaactcact
gctgccaatctcggccgtaactggatcatgattcctgctgtgacatatcacgaagatgcg
gatatcactgatttagaagcattccgagtattgactaataaagagaatgaaaagaagggt
gtcaaaattacgatgctcgccttcttaatgaaggctgcagtagctgccttgaaaaaatac
ccagaatttaatagttccttggatggtgatgatttgatattgaagaagtatttcaatatt
ggttttgctgctgatacccctaccggtttagtggtgcctgtcattaaagacgtagataaa
aaaggtatctttgatttagctaaagaaacttctgacttggccgccttggcccgtgatggc
aagctgaaacccgagcaaatgcaaggtgctagcttcactatttcctctttaggaggtatc
ggcggtacctatttctccccgatcgtgaatgcgccagaagtggctattttaggtgtgagt
aaggctgctatgaagccagtatgggacggtaagcaatttgtcccacgcctgatttgccca
ttgtcattatctgcagatcatcgtgtgattgatggcgccttagcgacacgttttaacgtg
tacattgctcaacttttagccgacttccgtcgcgctagtctgtaa

DBGET integrated database retrieval system