KEGG   Polynucleobacter asymbioticus: Pnuc_0759Help
Entry
Pnuc_0759         CDS       T00502                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00020  Citrate cycle (TCA cycle)
pnu00190  Oxidative phosphorylation
pnu00650  Butanoate metabolism
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01120  Microbial metabolism in diverse environments
pnu01130  Biosynthesis of antibiotics
pnu01200  Carbon metabolism
Module
pnu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pnu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnuc_0759
   00650 Butanoate metabolism
    Pnuc_0759
  Energy metabolism
   00190 Oxidative phosphorylation
    Pnuc_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABP33977
JGI: Pnuc0759
UniProt: A4SWW3
Position
760252..760617
Genome map
AA seq 121 aa AA seqDB search
MPIYQIGPKRLVVGAHYGLKEWIIQRVTAIVMVVFTIVLLVDYCITGSATYEGWSSLFSN
QFMKLLTLLAFISLFYHAWIGIRDIWMDYIKPVSIRLTLQVLTVLYLVACAAYAVQILWK
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcctatttatcaaattggaccaaagcgcttagttgttggtgcgcattacggcctcaaa
gaatggatcattcaacgcgtcaccgcgattgtgatggtggtatttacgattgttttattg
gttgactactgcatcactggtagcgcaacttatgaaggctggtcaagcctctttagcaat
caattcatgaagttattgacgttgttggcattcatcagcttgttctatcacgcttggatt
ggtatccgtgatatctggatggattacatcaagccggtcagtattcgtttaacactccaa
gtgttgaccgttctgtatctcgtagcctgtgcggcctatgccgtacaaattttgtggaaa
gtgtaa

DBGET integrated database retrieval system