KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0759Help
Entry
Pnuc_0759         CDS       T00502                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnuc_0759
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnuc_0759
   00650 Butanoate metabolism
    Pnuc_0759
  Energy metabolism
   00190 Oxidative phosphorylation
    Pnuc_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
760252..760617
Genome map
AA seq 121 aa AA seqDB search
MPIYQIGPKRLVVGAHYGLKEWIIQRVTAIVMVVFTIVLLVDYCITGSATYEGWSSLFSN
QFMKLLTLLAFISLFYHAWIGIRDIWMDYIKPVSIRLTLQVLTVLYLVACAAYAVQILWK
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgcctatttatcaaattggaccaaagcgcttagttgttggtgcgcattacggcctcaaa
gaatggatcattcaacgcgtcaccgcgattgtgatggtggtatttacgattgttttattg
gttgactactgcatcactggtagcgcaacttatgaaggctggtcaagcctctttagcaat
caattcatgaagttattgacgttgttggcattcatcagcttgttctatcacgcttggatt
ggtatccgtgatatctggatggattacatcaagccggtcagtattcgtttaacactccaa
gtgttgaccgttctgtatctcgtagcctgtgcggcctatgccgtacaaattttgtggaaa
gtgtaa

DBGET integrated database retrieval system