KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_0772Help
Entry
Pnuc_0772         CDS       T00502                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pnu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pnu00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pnu00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
772377..773570
Genome map
AA seq 397 aa AA seqDB search
MYDKPDARGHFGPYGGVFVSETLMYALEELKEAYAKYQHDPEFIEEFHYELKHFVGRPSP
VYHAKRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQHGV
ATATICARFGLDCTVYQGSVDVARQAQNVYRMKLLGAKVVPVESGTKTLKDALNEAMRDW
VTNVDNTFYIIGTVAGPHPYPMMVRDFQSVIGEECKVQMPEMTGRQPDFVLACVGGGSNA
MGIFYPYIDFPEVKLVGVEAAGHGLGSGLHSAALCVGKPGVLHGNRTYLLQDENGQISET
HSVSAGMDYPGVGPEHAWLKDSGRADYVAITDEEALKAFHDCCQIEGIIPALESAHAIAY
ACKLAKTLPKDKTILVNLSGRGDKDMHTVAQATGSEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacaagccagatgcaagaggacattttggtccttacggcggcgtgtttgtttct
gagacattgatgtatgcattagaggaactcaaagaagcctatgcaaaatatcaacacgat
ccagaatttattgaagagtttcattacgagttaaagcactttgttggtagaccttctccg
gtgtatcacgcaaaacgttggagcgaaatgcttggcggggcgcaaatctatttaaagcgt
gaagacttaaaccacactggtgcccataagattaataacgtaattggtcaagcgatgttg
gccaagcgtatgggtaagccccgcatcattgcggagactggggcagggcaacatggtgtt
gcaacggcaactatctgtgcacgatttggtcttgactgtactgtctatcaaggctctgtg
gacgtcgcacgtcaagctcaaaacgtatatcgcatgaaattactcggtgccaaagtggtg
ccagtagagtctggtactaaaacattaaaagatgcgctcaatgaggcaatgcgtgattgg
gttactaacgtcgataacactttctacatcatcggtactgttgccggtccacatccctat
ccaatgatggtgcgcgatttccaaagcgtgattggagaagagtgcaaagtgcagatgcca
gaaatgactgggcgtcaaccagactttgtattggcctgtgttggcggtggttcaaatgcc
atgggtattttttacccatacatcgatttcccggaagtgaaattagtaggcgtagaagct
gcaggtcatggcttgggtagtggtttgcattcagcggctctgtgtgtcggtaagcctggt
gtcttgcatggcaatcggacttacttactccaagatgagaacggtcagatttctgaaacg
cattctgtttctgctggtatggattaccccggtgttggtcctgagcatgcatggttaaaa
gactctggtcgtgctgactatgtagccattaccgacgaggaagctctaaaagccttccat
gattgctgtcagattgaaggcatcattcctgcgctggagtcagcccatgctattgcctat
gcctgcaagttggccaagactttgcctaaagataaaaccattttggtgaacctttctggt
cgtggcgataaggatatgcataccgttgctcaggcaactggttctgaaggctag

DBGET integrated database retrieval system