KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0772Help
Entry
Pnuc_0772         CDS       T00502                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnuc_0772
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnuc_0772
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnuc_0772
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnuc_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
772377..773570
Genome map
AA seq 397 aa AA seqDB search
MYDKPDARGHFGPYGGVFVSETLMYALEELKEAYAKYQHDPEFIEEFHYELKHFVGRPSP
VYHAKRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQAMLAKRMGKPRIIAETGAGQHGV
ATATICARFGLDCTVYQGSVDVARQAQNVYRMKLLGAKVVPVESGTKTLKDALNEAMRDW
VTNVDNTFYIIGTVAGPHPYPMMVRDFQSVIGEECKVQMPEMTGRQPDFVLACVGGGSNA
MGIFYPYIDFPEVKLVGVEAAGHGLGSGLHSAALCVGKPGVLHGNRTYLLQDENGQISET
HSVSAGMDYPGVGPEHAWLKDSGRADYVAITDEEALKAFHDCCQIEGIIPALESAHAIAY
ACKLAKTLPKDKTILVNLSGRGDKDMHTVAQATGSEG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacaagccagatgcaagaggacattttggtccttacggcggcgtgtttgtttct
gagacattgatgtatgcattagaggaactcaaagaagcctatgcaaaatatcaacacgat
ccagaatttattgaagagtttcattacgagttaaagcactttgttggtagaccttctccg
gtgtatcacgcaaaacgttggagcgaaatgcttggcggggcgcaaatctatttaaagcgt
gaagacttaaaccacactggtgcccataagattaataacgtaattggtcaagcgatgttg
gccaagcgtatgggtaagccccgcatcattgcggagactggggcagggcaacatggtgtt
gcaacggcaactatctgtgcacgatttggtcttgactgtactgtctatcaaggctctgtg
gacgtcgcacgtcaagctcaaaacgtatatcgcatgaaattactcggtgccaaagtggtg
ccagtagagtctggtactaaaacattaaaagatgcgctcaatgaggcaatgcgtgattgg
gttactaacgtcgataacactttctacatcatcggtactgttgccggtccacatccctat
ccaatgatggtgcgcgatttccaaagcgtgattggagaagagtgcaaagtgcagatgcca
gaaatgactgggcgtcaaccagactttgtattggcctgtgttggcggtggttcaaatgcc
atgggtattttttacccatacatcgatttcccggaagtgaaattagtaggcgtagaagct
gcaggtcatggcttgggtagtggtttgcattcagcggctctgtgtgtcggtaagcctggt
gtcttgcatggcaatcggacttacttactccaagatgagaacggtcagatttctgaaacg
cattctgtttctgctggtatggattaccccggtgttggtcctgagcatgcatggttaaaa
gactctggtcgtgctgactatgtagccattaccgacgaggaagctctaaaagccttccat
gattgctgtcagattgaaggcatcattcctgcgctggagtcagcccatgctattgcctat
gcctgcaagttggccaagactttgcctaaagataaaaccattttggtgaacctttctggt
cgtggcgataaggatatgcataccgttgctcaggcaactggttctgaaggctag

DBGET integrated database retrieval system