KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0773Help
Entry
Pnuc_0773         CDS       T00502                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnuc_0773 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnuc_0773 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnuc_0773 (trpA)
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnuc_0773 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
773621..774418
Genome map
AA seq 265 aa AA seqDB search
MSKITALFKELKASGKKGLIPFITAGDPDPKLTVELMHALVRGGSSVIELGVPFSDPMAD
GPVIQRSSERALTQGVTLHSCLDMVKEFRKKDATTPVVLMGYANPVEQMGAERFATEAKA
AGVDGVLIVDYPPEECVDFAARMRVAGIDPIFLLAPTSSHERIKEAAKIASGYIYYVSMR
GVTGASHLNTQDVASIIPKIREETDIPIAVGFGINDAASAKAVSVSADAVVIGSRIIRLL
EDAPPGQAVQSLETFIREIRDALDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaataactgcactctttaaagagctcaaagcaagcggaaagaagggattgatt
cccttcattactgccggtgatcctgatcccaaattaaccgtggaattaatgcatgcactc
gtgcgtggtggctctagcgtaattgaattgggcgtgccattctctgatccgatggctgat
ggtcccgtgatacagagatcttctgagcgtgctttgacacagggagttactttacatagc
tgcctagacatggtgaaagagtttcgcaaaaaagatgcaacgactccagtcgttttaatg
ggatatgcaaatcctgttgagcaaatgggtgcagagagatttgcaaccgaagcaaaagca
gctggggtagatggagtcctgattgttgactatccgcctgaggaatgcgttgattttgcg
gcacgcatgcgtgttgcaggaattgacccgattttcttattagcgccaacttcatcccat
gagcgcattaaagaggctgccaaaatagcttctggttatatctattacgtttccatgcgt
ggtgtaacaggcgcttcccatctcaatacccaggatgtagccagcatcatccctaaaatt
cgggaagaaaccgatattcctatcgccgtaggctttggaattaacgatgcagcaagtgcc
aaggctgtttcagtcagcgctgacgcagtggtcatagggagccggattattcgccttttg
gaggatgcaccccctgggcaggcagtacaatcattggaaaccttcattcgtgagattcgc
gacgcattggatagttaa

DBGET integrated database retrieval system