KEGG   Polynucleobacter asymbioticus: Pnuc_0773Help
Entry
Pnuc_0773         CDS       T00502                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00260  Glycine, serine and threonine metabolism
pnu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01130  Biosynthesis of antibiotics
pnu01230  Biosynthesis of amino acids
Module
pnu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnuc_0773
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnuc_0773
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnuc_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Peripla_BP_6 PcrB NMO DUF561 Lipase_GDSL_2 GCH_III
Motif
Other DBs
NCBI-ProteinID: ABP33991
JGI: Pnuc0773
UniProt: A4SWX7
Position
773621..774418
Genome map
AA seq 265 aa AA seqDB search
MSKITALFKELKASGKKGLIPFITAGDPDPKLTVELMHALVRGGSSVIELGVPFSDPMAD
GPVIQRSSERALTQGVTLHSCLDMVKEFRKKDATTPVVLMGYANPVEQMGAERFATEAKA
AGVDGVLIVDYPPEECVDFAARMRVAGIDPIFLLAPTSSHERIKEAAKIASGYIYYVSMR
GVTGASHLNTQDVASIIPKIREETDIPIAVGFGINDAASAKAVSVSADAVVIGSRIIRLL
EDAPPGQAVQSLETFIREIRDALDS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaataactgcactctttaaagagctcaaagcaagcggaaagaagggattgatt
cccttcattactgccggtgatcctgatcccaaattaaccgtggaattaatgcatgcactc
gtgcgtggtggctctagcgtaattgaattgggcgtgccattctctgatccgatggctgat
ggtcccgtgatacagagatcttctgagcgtgctttgacacagggagttactttacatagc
tgcctagacatggtgaaagagtttcgcaaaaaagatgcaacgactccagtcgttttaatg
ggatatgcaaatcctgttgagcaaatgggtgcagagagatttgcaaccgaagcaaaagca
gctggggtagatggagtcctgattgttgactatccgcctgaggaatgcgttgattttgcg
gcacgcatgcgtgttgcaggaattgacccgattttcttattagcgccaacttcatcccat
gagcgcattaaagaggctgccaaaatagcttctggttatatctattacgtttccatgcgt
ggtgtaacaggcgcttcccatctcaatacccaggatgtagccagcatcatccctaaaatt
cgggaagaaaccgatattcctatcgccgtaggctttggaattaacgatgcagcaagtgcc
aaggctgtttcagtcagcgctgacgcagtggtcatagggagccggattattcgccttttg
gaggatgcaccccctgggcaggcagtacaatcattggaaaccttcattcgtgagattcgc
gacgcattggatagttaa

DBGET integrated database retrieval system