KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0841Help
Entry
Pnuc_0841         CDS       T00502                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnuc_0841
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnuc_0841
  Amino acid metabolism
   00310 Lysine degradation
    Pnuc_0841
Enzymes [BR:pnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pnuc_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
835924..837099
Genome map
AA seq 391 aa AA seqDB search
MAIFEVKVPQLSESVAEATLLQWKKKVGDAVGQDEILIEIETDKVVLEVPAPSAGVLTEI
LVGDGGTVVAEQLIGKIDSTAVAAAAPAAIPAKAAAPAAKAGAAAAPSAAKILAEKNIDA
GQVAGSGRDGRITKGDALNASASSTKSATLPSAPIPTGDRPEERVPMSRLRARIAERLLE
SQANNAILTTFNEVNMGPVIALRNKYKDQFEKTHGVKLGFMSFFVKAATHALKKYPLLNA
SVDGNDIVYHGYFDIGIAVSSPRGLVVPILRDVDQMNLADIEKKIAEFGTKAREGKLSIE
ELTGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRAVVENGQVVVRPINYLALSY
DHRIIDGREAVLGLVAMKDALEDPSRLLLDL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctattttcgaagttaaagttccccaactctctgagtcagttgctgaagcaactttg
ttgcaatggaaaaagaaggttggcgacgccgttggtcaagatgagatcttgattgaaatt
gaaactgataaagtggttctcgaagtaccagctccttctgctggtgttctcactgaaatc
cttgtgggtgacggtggcactgttgttgctgaacagttgatcggtaagattgatagcact
gctgttgccgctgccgctcctgccgcaatacctgctaaagctgctgctcctgctgctaaa
gctggtgcagccgcggctccttcagctgcaaaaattcttgcagagaaaaatatcgacgct
ggtcaagttgcaggctctggacgtgatggtcgcatcactaaaggtgatgctttaaatgct
tctgcaagcagcacaaagtctgcgacactgccaagcgcaccaattccaactggcgatcgc
ccagaagagcgcgttccaatgagccgcttgcgcgcacgtattgctgagcgtttgcttgag
tcacaagctaacaacgctattttgactacattcaatgaagtcaatatgggcccagttatt
gccttacgtaacaaatacaaagatcagtttgaaaagactcatggcgtgaagttaggcttt
atgtctttcttcgttaaagcagccacacacgctttgaagaaatatccacttttgaatgcg
tctgtagatggtaatgacattgtttaccacggttactttgatattggtatcgccgttagc
tcaccacgcggcttggtagttccaatcttgcgcgatgttgaccaaatgaatttggctgat
attgagaagaagattgctgagttcggtacgaaagctcgcgaaggtaagctgtcaattgaa
gagttaactggcggcacattctccatctctaacggtggcgtatttggctccatgctgtcc
acaccaattattaatcctccgcaatcagcgatcttgggcatccatgccactaaagatcgt
gcagtagttgaaaacggtcaagtagttgttcgcccaattaactatttagctctgtcatat
gatcaccgcatcattgatggccgcgaagctgtgcttggtttagttgctatgaaggatgcc
ttagaagatccttcacgtctcctccttgatttgtaa

DBGET integrated database retrieval system