KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0938Help
Entry
Pnuc_0938         CDS       T00502                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pnuc_0938
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pnuc_0938
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pnuc_0938
Lipid biosynthesis proteins [BR:pnu01004]
 Fatty acid synthase
  Component type
   Pnuc_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(937962..938621)
Genome map
AA seq 219 aa AA seqDB search
MNQTRWTTYLKRNYVLTGLFCLLIPFITAAQTNPTILVLGDSLSAEYGLSRGTGWVKLLE
TQLQKDSSPWTVFNASISGETSSGGLTRTQKLLDDKKPRIVLLELGANDALRGLTIEQTQ
NNLKKIIELSKQSGSKVLLFGMQIPPNYGKEYAQQFKDLYGQLAKQEHIQLLPFFFNGLA
TNKELFQADNIHPNEKAQNILFKNVWGAMAPYYSMLKSR
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactagatggacgacttacttaaaaagaaactatgtattaacaggtctattt
tgcctgttaattccatttattaccgccgctcaaacaaatccgaccatcctagtcttggga
gatagcctttccgcggaatatggactgagccgaggtactggttgggtcaaattgcttgaa
actcagctgcaaaaggattccagcccgtggactgtatttaacgccagcattagcggtgaa
accagctctggcggcctgactcgtacgcaaaaacttctggatgataagaagcctaggatc
gttttgcttgagcttggcgcaaatgatgcactgagaggcttaacaatagagcagactcaa
aataacttaaaaaaaatcattgaactgagtaagcagtcagggtcaaaggttcttttattt
ggtatgcaaattccacccaattatggaaaagaatacgcgcaacaatttaaagacctctat
gggcaactagcaaaacaagagcacattcagcttctaccttttttctttaacggattagca
acaaataaggaattatttcaggccgataatattcatccgaatgaaaaggcccaaaacata
cttttcaaaaacgtatggggcgcaatggccccatattattcgatgcttaaatctcgctaa

DBGET integrated database retrieval system