KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_0952Help
Entry
Pnuc_0952         CDS       T00502                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Brite
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Pnuc_0952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(955552..956427)
Genome map
AA seq 291 aa AA seqDB search
MNLATNDDSSPLIVLFHGLSSSPLEFNFLGSQLIAAGYRVNTPSIQGYSFGGNATSWKSW
LSEAVSHVQGLQANESKPITLGGISLGSTLALAVASELNDILGVLALSTTLKYNGWAVPW
YRALIPAGMVLGLGDRYKYMEKDPFGIKNPQIRAYIKRVLTSQDVSDVGGLYMSLRHMHE
GNKLCKYVIKNLATVSSAILTIHAVDDEIANVLNAQLVAERTSATMVRQIYLGDSYHMIT
VDNERETVAAEVRSFLDSIYGKFKPEPYEDKILSPELQRFLRNIKRGKESK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttgcaacgaatgatgattctagccctttaattgtactatttcatgggctttcc
tcatccccgctagagtttaatttccttggctcacaactaattgctgccggatatagagtg
aatactcccagcattcaggggtattctttcggtggaaacgccaccagctggaaaagttgg
cttagcgaagctgtttcacatgttcagggtttacaggcaaacgaatccaagcccattacc
ttgggtggcatctcattaggttcaaccttggccttagctgtcgcatccgaactaaacgac
atcttaggcgtccttgccctatccaccaccctcaaatataacggctgggcagtgccatgg
tatcgtgccctgatcccagcaggaatggttttggggcttggggatcgctacaaatatatg
gaaaaggacccttttggcattaaaaacccccaaattcgtgcatatattaagagggttctt
acaagtcaagatgtgtcggatgttggcggcttatatatgtctttgagacatatgcatgaa
ggtaataagctatgtaaatatgtaataaaaaatttagcgacagtaagttcagccattttg
actattcacgcagtagatgacgaaattgcaaacgtacttaatgcgcaattagtggcagag
cgcactagcgctaccatggtacgacaaatttatctcggtgatagctaccatatgattacc
gtcgataatgaacgcgaaacagttgctgctgaagttcgtagtttcctagattctatttat
ggaaaatttaagccagagccctatgaggataaaattttgtcccctgaattgcaacgtttt
ttgcgcaatatcaaaagaggcaaggaaagcaaataa

DBGET integrated database retrieval system