KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1053Help
Entry
Pnuc_1053         CDS       T00502                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnuc_1053 (tpiA)
   01230 Biosynthesis of amino acids
    Pnuc_1053 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnuc_1053 (tpiA)
   00051 Fructose and mannose metabolism
    Pnuc_1053 (tpiA)
   00562 Inositol phosphate metabolism
    Pnuc_1053 (tpiA)
Enzymes [BR:pnu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pnuc_1053 (tpiA)
Exosome [BR:pnu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pnuc_1053 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pnuc_1053 (tpiA)
  Exosomal proteins of melanoma cells
   Pnuc_1053 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1056379..1057137)
Genome map
AA seq 252 aa AA seqDB search
MRPLIVIGNWKMNGNLASNQDWVKTVARGMESGMPAGRKFAVCPSFPYLSQCSTLIKEHS
LAFLSLGAQDVSAHGAGAYTGEVGASMLKEMGCEYVIVGHSERRQMHQEADESVAAKALQ
ALDSGMTPVICVGETADERNSGRAEEIVCSQVAKQVSVLQDRLADCLIAYEPVWAIGTGK
VASAQVAQDMHRAIRMQLAEFDEDVASHVGILYGGSVKPDNAVELFAMPDIDGGLVGGAS
LNPQDFLAICQA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccacttatcgtcattggcaactggaaaatgaacggcaatcttgctagtaatcaa
gattgggtcaagaccgttgcccgtggcatggaaagtggcatgccagccggacgtaagttt
gctgtatgtccgtcatttccgtatttatctcaatgttctactttgattaaagagcattct
ttagcttttttaagcttaggcgctcaagatgtttctgctcatggcgctggtgcttatacc
ggtgaagtaggcgcatccatgctaaaagaaatgggttgtgaatacgtcattgttgggcat
tcagagcgtcgccagatgcatcaagaggctgatgagtctgtcgcagctaaagcattgcag
gcattagatagcggcatgacgccagtgatttgtgtcggtgaaactgctgacgagcgtaac
tcgggtagggcggaagagattgtttgctcccaagtggctaaacaggtatcagttcttcag
gatcgattggctgattgcttgattgcttatgagcctgtttgggctattggcactggaaaa
gtagctagcgctcaagtggcgcaagatatgcatcgtgcaattcgtatgcaattagccgaa
tttgatgaagatgtagcgtcacatgttggaattttgtatggcggcagcgtcaagcctgat
aatgctgtcgaattatttgcaatgccagatattgatggtggattggttgggggtgcttca
ctaaatccgcaagactttctggccatctgtcaggcatag

DBGET integrated database retrieval system