KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1167Help
Entry
Pnuc_1167         CDS       T00502                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pnuc_1167
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pnuc_1167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1221945..1222958
Genome map
AA seq 337 aa AA seqDB search
MTFSPLLRSWLVTIALGVISSNAICADQDWQQFKNAYIQNGRVIDSGQDGMSHTEGQGVA
MLLAVKNNDPQTFELVWNWTQHNLQVREDKLLAWSWSPTQGVMDTNNASDGDLFIAWALS
QAYTRWQEPRYLFYALQISQSIREKLIRKTNFGTVILPGAFGFEKPEGLKLNLSYWVFPA
ITELAVLDPAPEWNELQLTGLRLLEQAQYGKWKLPPDWLMYKDGISTPTDGNRFGYDAVR
IPLYLIWGNQAGNSNMKPFQSFWSSFQGQEFLPAWVDLKTGDIGTYNASLGFHSIAALTL
SYPQIDLAQLPNFDPTEGYYSSMLYLFTKSAVEDLKK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactttttccccattacttcgatcttggcttgtgactatagcccttggggtaatctcc
agtaatgcaatttgtgcagatcaagattggcaacagtttaaaaatgcgtacatccagaat
ggccgagtaattgatagcggtcaggatggaatgagtcataccgagggtcaaggagtagca
atgctccttgcggttaaaaataatgatccccaaacatttgaactcgtctggaattggacg
cagcacaatcttcaagttcgagaagataagttactcgcctggagctggtcccccactcaa
ggtgtgatggatactaataatgcaagtgatggtgatctatttatcgcctgggccctctct
caagcctatacgcgttggcaagaaccacgctaccttttttatgccttacaaattagtcaa
tcaattcgtgaaaaactcatacgtaaaacgaactttggtacggtcattcttccaggagca
tttggctttgaaaaaccagaaggcctcaagctcaatctgtcgtactgggtttttcctgca
attaccgagttagccgttctcgatccagcgccagaatggaatgagcttcaattgactgga
ctgcgcttacttgagcaagcgcaatatggaaaatggaagttgccgcctgattggctaatg
tataaggatggcattagcactccaaccgatggaaaccgctttggctacgatgcagtccgt
atccccttgtatcttatttgggggaatcaggctggcaactcgaatatgaagccttttcaa
tctttttggagctcatttcaggggcaagaattcctaccggcctgggttgaccttaagacc
ggggatatcggaacgtacaatgcatcattgggctttcacagtatcgctgccctcaccctt
tcctaccctcagattgatttagcccaactcccgaactttgatcctacagaaggctattac
tcctccatgctctatctatttacaaagtctgctgtcgaggatctaaaaaaataa

DBGET integrated database retrieval system