KEGG   Polynucleobacter sp. QLW-P1DMWA-1: Pnuc_1167Help
Entry
Pnuc_1167         CDS       T00502                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pnu  Polynucleobacter sp. QLW-P1DMWA-1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pnu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1221945..1222958
Genome map
AA seq 337 aa AA seqDB search
MTFSPLLRSWLVTIALGVISSNAICADQDWQQFKNAYIQNGRVIDSGQDGMSHTEGQGVA
MLLAVKNNDPQTFELVWNWTQHNLQVREDKLLAWSWSPTQGVMDTNNASDGDLFIAWALS
QAYTRWQEPRYLFYALQISQSIREKLIRKTNFGTVILPGAFGFEKPEGLKLNLSYWVFPA
ITELAVLDPAPEWNELQLTGLRLLEQAQYGKWKLPPDWLMYKDGISTPTDGNRFGYDAVR
IPLYLIWGNQAGNSNMKPFQSFWSSFQGQEFLPAWVDLKTGDIGTYNASLGFHSIAALTL
SYPQIDLAQLPNFDPTEGYYSSMLYLFTKSAVEDLKK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgactttttccccattacttcgatcttggcttgtgactatagcccttggggtaatctcc
agtaatgcaatttgtgcagatcaagattggcaacagtttaaaaatgcgtacatccagaat
ggccgagtaattgatagcggtcaggatggaatgagtcataccgagggtcaaggagtagca
atgctccttgcggttaaaaataatgatccccaaacatttgaactcgtctggaattggacg
cagcacaatcttcaagttcgagaagataagttactcgcctggagctggtcccccactcaa
ggtgtgatggatactaataatgcaagtgatggtgatctatttatcgcctgggccctctct
caagcctatacgcgttggcaagaaccacgctaccttttttatgccttacaaattagtcaa
tcaattcgtgaaaaactcatacgtaaaacgaactttggtacggtcattcttccaggagca
tttggctttgaaaaaccagaaggcctcaagctcaatctgtcgtactgggtttttcctgca
attaccgagttagccgttctcgatccagcgccagaatggaatgagcttcaattgactgga
ctgcgcttacttgagcaagcgcaatatggaaaatggaagttgccgcctgattggctaatg
tataaggatggcattagcactccaaccgatggaaaccgctttggctacgatgcagtccgt
atccccttgtatcttatttgggggaatcaggctggcaactcgaatatgaagccttttcaa
tctttttggagctcatttcaggggcaagaattcctaccggcctgggttgaccttaagacc
ggggatatcggaacgtacaatgcatcattgggctttcacagtatcgctgccctcaccctt
tcctaccctcagattgatttagcccaactcccgaactttgatcctacagaaggctattac
tcctccatgctctatctatttacaaagtctgctgtcgaggatctaaaaaaataa

DBGET integrated database retrieval system