KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1280Help
Entry
Pnuc_1280         CDS       T00502                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnuc_1280
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnuc_1280
   00630 Glyoxylate and dicarboxylate metabolism
    Pnuc_1280
Enzymes [BR:pnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pnuc_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1349165..1351378)
Genome map
AA seq 737 aa AA seqDB search
MTARTTCNSLQVATPLYRFIEDKVLPGTGIKSADFWKGFDEIVKDLTPKNEALLAKRDRI
QVDLDKWHQANPGPIKDMPAYRKFLKEIGYLDDVPGKVLGTTENVDDELALQAGPQLVVP
VLNARYALNAANARWGSLYDALYGTDVLSEEDGATKAGAYNPIRGAKVVAFARNFLDQSA
PLAKGSHRDAVSYTVDGNKLSIKLKDGSTTGLADEKQFVGYQGDAAAPSSILLRNNGVHI
DIEIDKSKTIGSGDPAGINDVVLEAALSTILDLEDSIAAVDGDDKVLAYENWLGILKGTL
VEEVSKGGKTITRALNPDRKYKAGIGAVNAKDGVVTLHGRSLLFLRNVGHLMTNPAIITG
EGKEIYEGILDAVVTVLIALYDINRPATQAIGNTRKGSVYIVKPKMHSPEEVAFAGELFG
RVEKLLGLPANTVKLGIMDEERRMSANIKAAIAAAGARVAFINTGFLDRTGDEMHTSMYA
GPMIRKGDMKASKWLSAYERRNVFAGLDCGLRGRAQIGKGMWAMPDLMKAMVEQKIVHPK
AGANTAWVPSPTAATLHALHYHQVNVAELQKEMEKVDTAAEAEALLNDLLTIPVAEQANW
SKEEIQQELDNNCQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLL
HGVVTADQVNETLQRMAKVVDGQNAGDSLYKPMMPHYKDSYAYKAASDLIFKGLEQPNGY
TEPLLHAWRLEVKKANA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgactgcgcgcactacctgcaatagccttcaagtggcaacccctctataccgttttatt
gaagacaaagtccttccaggaactggaattaagagtgctgacttttggaaaggctttgat
gaaattgttaaagacctcacccctaaaaatgaagcattgctagctaagcgcgatcgcatt
caggtggacttggataaatggcatcaagctaatcctggcccaattaaagatatgcctgct
tatcgcaagttcctaaaagaaattgggtacttagatgatgttccaggaaaagtattgggc
actaccgagaatgtggatgatgagttggcattgcaagctggcccacaactcgtggttcca
gttctcaacgcgcgttatgcattaaatgcggccaatgctcgttggggttctttatatgat
gctctgtacggcactgacgtactttctgaagaagacggcgctacaaaagcgggcgcatac
aacccaatacgtggtgcgaaggttgtagcctttgctcgcaatttcctggatcagtccgcc
cctttggctaaaggctctcatcgcgatgccgtttcatatacggttgatggcaataaatta
tcaatcaagctcaaggatggcagcacaacaggcctggcagatgagaaacaattcgtaggc
taccagggcgatgcggctgcgcccagctcaattttgttgcgcaataacggtgtgcatatt
gatatcgaaattgataagagcaaaacgattggctcaggcgatcctgctggtattaatgac
gtagtactcgaagcagcactctctaccattttggatttggaagactctattgctgcagta
gatggcgatgacaaagtgctggcctatgaaaactggcttggcatcctaaaaggtactttg
gttgaagaggtaagtaagggtggaaaaactattacccgtgccttgaatcctgatcgcaag
tacaaggcaggtattggtgccgtaaatgcaaaagatggagttgtgactttgcatggccgc
tcactcttgttccttcgtaacgttggccacctcatgaccaacccagcaatcatcactggc
gaaggcaaagagatttacgaaggtattttggatgcagtagttacagtattgattgcgttg
tacgacattaatcgtccagcgactcaggctattggaaacacacgtaagggttctgtttat
atcgttaaaccaaaaatgcatagccctgaagaggttgcttttgcaggcgaattgtttgga
cgtgttgagaaattgttaggcttaccagccaatacagtgaagttaggcatcatggatgaa
gagcgtcgtatgagcgccaacatcaaagcagcaattgcagcggctggtgcacgcgtagcc
tttattaataccggtttcttggaccgtactggcgacgaaatgcacacctctatgtatgcg
ggcccaatgattcgcaagggcgatatgaaagccagcaaatggttatccgcttatgagcgt
cgcaatgtgtttgcaggtctagactgtggtttacgtggtcgcgcccaaattggtaagggc
atgtgggctatgccagacttgatgaaagccatggttgagcagaagatcgttcacccgaaa
gcaggtgcaaatactgcttgggttccatcaccaacagctgctactttgcatgcgcttcat
taccaccaagtcaatgtagcggaactccaaaaagaaatggaaaaggttgatacggcagcg
gaagctgaagcattgctgaatgatctcttaacgattccggtagcagagcaagcaaattgg
tctaaagaagaaattcaacaagaattagataacaactgccaaggtatcttgggttatgta
gttcgttggattgatcaaggcgttggttgctccaaggttcctgatattcataacgttggc
ctcatggaagaccgcgctacattgcgtatttccagtcagcatattgcaaactggctattg
cacggcgttgttactgccgatcaagtcaacgagacattgcaacgtatggctaaagtggtt
gatgggcaaaatgctggtgactctttgtacaagcctatgatgccccattacaaagattct
tacgcttataaagctgcaagcgacttgattttcaagggtctcgagcagcccaatggctac
acagagcctttgttgcacgcttggcgcttagaagtaaagaaggcgaacgcatag

DBGET integrated database retrieval system