KEGG   Polynucleobacter asymbioticus: Pnuc_1386Help
Entry
Pnuc_1386         CDS       T00502                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00072  Synthesis and degradation of ketone bodies
pnu00650  Butanoate metabolism
pnu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Pnuc_1386
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Pnuc_1386
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Pnuc_1386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Eno-Rase_NADH_b Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ABP34600
JGI: Pnuc1386
UniProt: A4SYN6
Position
complement(1456513..1457289)
Genome map
AA seq 258 aa AA seqDB search
MSTLKGKTALVTGSTSGIGLGMAIALAKQGANIMVNGFGEKDDALAQIKACGVEVDYHGA
DMSKPAEIEDLIKQTEKRFGSLDILVNNAGIQYTANIEDFPADKWDAIIAINLSSAFHTT
HHALPGMQKRNWGRIINIASVHGLVASTQKAAYVAAKHGIVGLTKVTALENARTGITCNA
ICPGWVLTPLVQKQVDARAERDGVSNEAAKIALVSEKQPSGQFVTPEQLAALAVFLCGPD
ASEVRGVAWNMDGGWTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacattaaaaggtaaaacagcattagtaactggttctactagcggtattggtcta
ggtatggcgattgcactagctaagcagggcgccaacatcatggtgaatggctttggtgaa
aaagatgatgcccttgcgcaaattaaagcctgtggcgttgaggttgactaccacggcgcg
gacatgagcaagccagctgaaattgaagatttaattaagcaaacagaaaaacgttttggc
tcattagatatattggtgaataacgcaggtattcaatacaccgccaacatcgaagatttt
cctgcggataaatgggatgccattattgccatcaatttgagttctgcgtttcatacaacg
catcatgctctgcctggaatgcaaaaacgcaattggggccgtattattaatattgcatca
gtgcatggcttagtagcgtcaacacaaaaggccgcgtatgtcgcggcaaaacacggcatc
gttggactcaccaaggtaaccgctttggaaaatgcgcgtaccggtattacttgtaatgca
atttgcccaggctgggttctcactccattagttcaaaaacaagttgatgcccgcgcagag
cgagatggcgtttcaaatgaagcagcaaaaattgcgctcgtttctgaaaaacaaccttct
ggacaatttgtgacccctgagcaattggctgctttggctgtatttttatgtggcccagac
gcctctgaagtccgtggggtagcctggaatatggatggtggctggactgcccagtaa

DBGET integrated database retrieval system