KEGG   Polynucleobacter asymbioticus: Pnuc_1445Help
Entry
Pnuc_1445         CDS       T00502                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00900  Terpenoid backbone biosynthesis
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnuc_1445
Enzymes [BR:pnu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Pnuc_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABP34659
JGI: Pnuc1445
UniProt: A4SYU5
Position
complement(1516465..1517649)
Genome map
AA seq 394 aa AA seqDB search
MAMRQVAILGSTGSIGVNTLDVIRAHPARFNVVALTAGKQIELLAQQCVEFKPMIAVVSE
AGDAARLEKMLLEQGVSTQVMYGPDALVSAVTESSCDTVMAAIVGAAGLVPALAAAKAGK
RVLLANKEALVMSGNLFMQAMKSGGGELLPIDSEHNAIFQCLPNEFTKSTHNGLGVEELW
LTASGGPFRSTPIEQLAAITPEQACAHPNWVMGRKISVDSATMMNKGLEVIEAFWLFGLP
LEKIKVLIHPQSVVHSMVRYRDGSVLAQLGQPDMRTPIAYGLAWPERIEAGVAPLDLAQL
AALNFSEPELARFPCLSLAFAAAKAGGTAPAVLNAANEVAVAAFLDAGLPYLQIPQVVEK
TLDAIAVTNADSLETILAIDAQARSVAHDLMRQY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgcggcaggttgccatactcggctcaacgggctctattggggtcaacaccttg
gatgtcattcgtgctcatcctgctcgttttaatgtagttgcccttacggctggaaagcaa
atcgagctcttggctcagcaatgtgttgaatttaaacccatgattgcggttgttagcgaa
gcgggggatgctgctcgcctggagaagatgctgcttgagcagggggtttctacgcaagtg
atgtatggtccagatgccttagtgagcgctgttactgagtcgtcttgcgatacggtaatg
gcagctatagtcggggcagctgggttggtgccagcattggctgcagcaaaagcaggtaag
cgagttttgctggccaataaagaagctttggtgatgtcgggcaatttatttatgcaagcc
atgaaaagtggcggtggtgagttacttccgattgatagcgaacataatgcgatctttcaa
tgcctgccaaatgaatttactaagtcaacgcacaatggtcttggcgttgaggagctgtgg
ttaactgcttcaggtggaccatttcgcagtacgcctattgaacagctggcggccattact
ccagagcaggcttgcgctcatcccaattgggtaatgggcagaaaaatttccgttgattca
gcaaccatgatgaacaaaggccttgaagtgattgaagctttttggttgtttggtttgcca
cttgaaaaaattaaagtattaattcatccacaaagcgtggtgcattcaatggtgcgttat
cgtgacggctcagtattggcgcaattaggacaacctgatatgcgcactcctattgcctat
gggctagcttggccagagcgtattgaggccggggttgccccattagatttagcgcagttg
gcggccctgaatttttcagagcctgaattagcgcgcttcccatgcctctctcttgcgttt
gcggcagccaaagctggcggtactgctccggcagtacttaatgccgcgaatgaagtggca
gtagccgctttcttggatgctggtttaccgtatttgcaaatacctcaagtggttgagaaa
accctagatgcaattgctgtcaccaatgcggattcgttagaaaccatcttggctattgat
gctcaagccagatcagtggctcatgacttgatgcgtcagtattaa

DBGET integrated database retrieval system