KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1506Help
Entry
Pnuc_1506         CDS       T00502                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnuc_1506
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pnuc_1506
Enzymes [BR:pnu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pnuc_1506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(1580465..1581763)
Genome map
AA seq 432 aa AA seqDB search
MADRKAEIAALQKDWDTNPRWKGITRGYTAEDVVRLRGSLKIEHTLAKHGAERLWELVNN
EAYVNCLGALTGGQAMQQVKAGVQAIYLSGWQVAADGNSYAAMYPDQSLYPVDSVPKMVE
RINNSFQRADEIQTAKGIQRGDAGFIEYFAPIVADAEAGFGGVLNAFELSKALIKQGAAG
VHFEDQLSSVKKCGHLGGKVLLPTSESVQKLISARLAADVMGTPTIILARTDAEAADLLT
SDYDENDKPFLTGERTPEGFYKTRKGLDQAISRGLAYAAYADMVWCETGTPDLDFARQFA
EAIRAKFPGKMLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKYQFITLAGIHSMWYNM
FDLAQDYMQRGMTAYIEKVQEPEFAARDRGYTFVSHQQEVGTGYFDDVTTVIQGGKSSVT
ALTGSTEEEQFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcagatcgcaaagcagaaatcgcagcgttacaaaaagattgggacaccaatccacgc
tggaaaggtattactcgtggttatacggctgaggacgttgtacgtcttcgcggctcattg
aagattgagcacactttagccaagcatggcgcagagcgtctatgggaattggttaataac
gaagcttacgttaactgtttaggtgctttgactggtggtcaagcaatgcaacaagttaaa
gctggcgtacaagcaatttatttatctggttggcaagtggctgctgacggtaactcatac
gcagcgatgtatccagaccaatctttatatccagtagattcagttcctaaaatggttgag
cgtattaataactcattccaacgtgctgacgaaattcaaactgcaaaaggtattcagcgt
ggcgatgctggctttatcgaatatttcgcgccaatcgttgctgatgctgaagcaggtttc
ggtggcgtattgaatgcatttgagttaagcaaggcattgatcaagcaaggtgctgctggc
gttcactttgaagaccaattgtcttcagtgaagaagtgcggtcacttgggtggtaaggtc
ttgttgcctacatctgaatcagttcaaaaattgatctctgcacgtttggctgcagacgta
atgggtactccgacgatcatcttggcccgtaccgatgctgaagctgccgacttgttgacc
tcagactacgatgagaatgacaagccattcttgacaggcgagcgtactccagaaggcttc
tacaaaacacgtaagggcttagatcaggcgatctcccgtggtctcgcatacgctgcttac
gcagatatggtttggtgtgaaacaggtactcctgatctggattttgctcgtcagtttgct
gaagcaattcgtgcgaagttcccaggaaagatgttggcatacaactgctcaccttctttc
aactggaagaaaaacctggatgacgcaacaattgctaaattccaacgtgagttgggcgcg
atgggttacaagtatcaatttattactctcgctggtatccactctatgtggtacaacatg
ttcgacttggcgcaagactacatgcaacgcggtatgactgcctacatcgagaaagtacaa
gagccagaatttgcagcacgtgatcgtggatacaccttcgtttcacatcagcaagaagtt
ggtactggttatttcgatgatgtaacaacagttattcaaggtggtaagtcttccgtaacg
gccttaactggttctactgaagaagagcagttccactaa

DBGET integrated database retrieval system