KEGG   Polynucleobacter asymbioticus: Pnuc_1552Help
Entry
Pnuc_1552         CDS       T00502                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00010  Glycolysis / Gluconeogenesis
pnu00020  Citrate cycle (TCA cycle)
pnu00620  Pyruvate metabolism
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01120  Microbial metabolism in diverse environments
pnu01130  Biosynthesis of antibiotics
pnu01200  Carbon metabolism
Module
pnu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnuc_1552
   00020 Citrate cycle (TCA cycle)
    Pnuc_1552
   00620 Pyruvate metabolism
    Pnuc_1552
Enzymes [BR:pnu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pnuc_1552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N GCV_H DUF3567
Motif
Other DBs
NCBI-ProteinID: ABP34766
JGI: Pnuc1552
UniProt: A4SZ52
Position
complement(1623838..1625256)
Genome map
AA seq 472 aa AA seqDB search
MLIKAFYSQYLASYLAKNTPKLASYLLLLGIGAALAIEILVPDIGDYQNIPVIEVLVQVG
DQIEKEQSILTLESDKATMDVPSSHSGIVKEIKVKIGDLLSQGKSVIVLEDGLPSDATSN
ESEHISQSTIEVINKAKTNELLTIDGSRAESSKEIISSLVSNDPNDESREAWASPSARKF
AREFGVDLQKVKGSGIKGRVTKEDIQLLIKSTMSTIGANTERASAGISGMDILPWPKVDF
SKFGSIERVARSRIQKVSAANLARNWLMIPAVTYHDDADITDLEKFRSDLNKEGKKDAVK
ITLLAFLIKAAVAALKKYPTFNASLDGEELILKKYCHIGFAVDTNIGLVVPVIRNADQKG
ILEIAKETAELAQLARDGKLKPEQMQGASFTISSLGGIGGTYCAPIINAPEVAILAVNKS
AIKPVWDGAEFIPRLICPLSMTADHRVIDGALATHFTTYLAQLLADFRKVLL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcttataaaagcgttttatagccaatatttagcatcctatttggcaaaaaatactcca
aaattagcctcatatttattactattaggcattggagcggctttggcgattgagattctt
gttcccgatataggggactatcaaaacatccctgtgattgaggtattggtacaagtgggt
gatcagattgagaaagagcaatctattttgaccttggagtccgataaggcaactatggat
gtgccgtcttctcattcgggaatcgtgaaagaaattaaggtcaagattggcgatctactt
tctcaagggaagtcagtcatcgtcctggaggatggcctaccatctgatgctacaagcaat
gaatctgagcatatctcgcaaagcactattgaagtcatcaataaagcaaagaccaatgaa
ctcttgactatcgatgggtctcgagcagagtcctctaaagaaatcatttcaagtttggtc
agcaatgaccctaatgatgaaagtcgagaagcatgggcaagtccttccgcgagaaagttc
gcccgtgaatttggtgtggatctacaaaaagtaaaaggcagtggaataaaaggccgggtg
acgaaagaagatattcagctattgattaaaagtacgatgtccactattggggccaatact
gaaagggcttccgcgggaatttcaggaatggatatcttgccttggccaaaggtggacttc
agcaaatttggctccatagagagggtcgcacgctcgcggattcagaaagtatcggcagcc
aatcttgctcgcaattggctcatgattccagcggtaacttatcacgatgatgcggatatt
actgatctggagaaattccgcagcgacctcaataaagagggtaaaaaagatgcggtgaag
attaccctgctggctttcctaattaaggcagctgtagctgccttaaagaaataccctact
ttcaatgcttcacttgatggtgaggaattgatccttaaaaaatattgccatattggcttt
gcagtcgataccaatattggattggtggtaccggtgattcgcaatgcggatcaaaaaggg
attttagagattgctaaagaaaccgcagaacttgcccaattagcgcgtgacggaaagctt
aagccagagcaaatgcagggagctagttttacgatctcttccttagggggtataggggga
acttactgtgctcccatcattaacgccccagaagtggcgatattagccgtcaataagtcc
gccataaagcccgtctgggatggtgccgagtttattcctcgcttgatctgtccgttatcc
atgactgctgatcatcgtgtaattgatggcgctttagctacccacttcactacttattta
gctcagcttttagctgattttcgcaaagtgctcttgtga

DBGET integrated database retrieval system