KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1558Help
Entry
Pnuc_1558         CDS       T00502                                 

Definition
(GenBank) short chain enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Pnuc_1558
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pnuc_1558
   00650 Butanoate metabolism
    Pnuc_1558
  Lipid metabolism
   00071 Fatty acid degradation
    Pnuc_1558
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnuc_1558
   00310 Lysine degradation
    Pnuc_1558
   00360 Phenylalanine metabolism
    Pnuc_1558
   00380 Tryptophan metabolism
    Pnuc_1558
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pnuc_1558
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pnuc_1558
   00281 Geraniol degradation
    Pnuc_1558
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnuc_1558
   00627 Aminobenzoate degradation
    Pnuc_1558
   00930 Caprolactam degradation
    Pnuc_1558
Enzymes [BR:pnu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pnuc_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1629884..1630660)
Genome map
AA seq 258 aa AA seqDB search
MTYENIIVAKHGKVALITLNRPKALNALSPDLTRELGEALDVLEIDPTVAAVVLTGSEKA
FAAGADIKVMKDWSYMDVYSANFITATWERIAKFRKPTIAAVAGYALGGGCELAMMCDFI
IAADNAKFGQPEITIGTIPGAGGTQRLTRLIGKSKAMEMVLTGRMMDAVEAERAGLVTRI
VPADQLISDALKTAEKIASMSMPIAMMAKDAVNRAYEVSLSEGIHFERRLFHSTFATEDQ
KEGMNAFSEKRPPVFKDK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaaaatattatcgttgctaaacatggcaaagttgctctcatcacactcaat
cgcccaaaggcattgaatgcattgagccccgatctcactcgtgaattgggggaggccctt
gatgttctcgagatagatccaacagttgcggctgtcgtattaactggtagtgaaaaagca
tttgcggctggtgccgatattaaggtcatgaaagactggtcttacatggatgtctatagt
gctaactttattactgctacctgggagcgcattgctaagtttcgcaagccaaccattgct
gcagtagcgggttatgcactgggtggtggttgcgagttagcgatgatgtgtgattttatt
attgcagcggataatgctaaatttggtcaacctgaaattactattggtacgattccaggg
gctggtggtacacagcgtttaacccgtctcattggtaaatccaaggcgatggaaatggtg
ttgactggccgcatgatggatgctgtcgaggctgagagggctggcttagtaacgcgcatt
gttcctgctgatcaactcatatccgatgccttgaaaactgcagagaagattgcctcgatg
tctatgcccattgcgatgatggcgaaggatgctgtgaatagggcgtatgaagtttcatta
agcgaaggcattcatttcgaacgacgtctcttccactcgactttcgccaccgaagatcaa
aaagaaggtatgaacgctttctcagaaaaacgtccaccagtatttaaagataaataa

DBGET integrated database retrieval system