KEGG   Polynucleobacter asymbioticus: Pnuc_1717Help
Entry
Pnuc_1717         CDS       T00502                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pnuc_1717
   00052 Galactose metabolism
    Pnuc_1717
   00500 Starch and sucrose metabolism
    Pnuc_1717
   00520 Amino sugar and nucleotide sugar metabolism
    Pnuc_1717
Enzymes [BR:pnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pnuc_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1787764..1788654
Genome map
AA seq 296 aa AA seqDB search
MSLHFSSKKVTKAVFPVAGFGTRFLPATKASPKEMLNVVDKPLIQYAVDEAIAAGITELI
FVTGRSKRAIEDHFDKAYELEAALEAKNKQDLLHLVRSVKPDNVDCVYIRQSEPLGLGHA
VLCAEKLVGDEPFAIILADDLLDGQPPVLSQMLKVHEEQEGSVLAVEKIDPSKSSSYGII
SGKEVQQGIYRLDGIVEKPKPADAPSNLAVVGRYVLSSKIFDHIRNVKPGAGGEIQLTDA
IAALLKDEPVFGYEYDGVRYDCGSKLGYLKASVDFALRHPEVGEDFAEYLKSWSLK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacatttcagctccaaaaaggtcactaaagcagtttttccagtagccggtttt
ggtacgcgctttttgccagcaaccaaggcaagcccaaaagaaatgctcaatgtcgtagat
aagccactcattcaatatgcagtggatgaagcgattgctgccggcattaccgaattaata
tttgtaaccggtcgtagcaaacgcgcaattgaagaccactttgataaagcttatgaatta
gaagctgctcttgaagcaaagaataagcaagacctactccatctagtgcgcagcgttaag
cccgacaatgtcgattgcgtttacattcgccaatctgaacctctgggtttgggtcatgca
gttttatgtgctgaaaaattagttggagatgagccgtttgccattatcttggccgacgat
cttttggatggacaaccaccagtgctttcgcaaatgctcaaagtgcatgaagagcaagag
ggttcagtgctcgctgttgagaagatcgatccatccaaatcgagctcctatggcatcatt
tcaggtaaggaagtgcaacaaggcatctatcgcttagatggcattgttgaaaagccaaag
ccagcagatgcaccatctaatctcgcggttgtaggtcgctatgttctgtcttccaaaatt
tttgatcacattcgcaatgtcaagccaggtgctggtggtgaaattcaactgacggatgcc
attgcggccttgctcaaggatgagcccgtgtttggatatgagtacgacggcgtgcgttat
gactgcggtagcaaattgggctatctcaaagcctctgttgactttgcattgcgtcaccca
gaagtaggcgaagattttgcagaatacttaaaaagctggtccttgaaataa

DBGET integrated database retrieval system