KEGG   Polynucleobacter asymbioticus: Pnuc_1717Help
Entry
Pnuc_1717         CDS       T00502                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00040  Pentose and glucuronate interconversions
pnu00052  Galactose metabolism
pnu00500  Starch and sucrose metabolism
pnu00520  Amino sugar and nucleotide sugar metabolism
pnu01100  Metabolic pathways
pnu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pnuc_1717
   00052 Galactose metabolism
    Pnuc_1717
   00500 Starch and sucrose metabolism
    Pnuc_1717
   00520 Amino sugar and nucleotide sugar metabolism
    Pnuc_1717
Enzymes [BR:pnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pnuc_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD SpoU_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABP34930
JGI: Pnuc1717
UniProt: A4SZL6
Position
1787764..1788654
Genome map
AA seq 296 aa AA seqDB search
MSLHFSSKKVTKAVFPVAGFGTRFLPATKASPKEMLNVVDKPLIQYAVDEAIAAGITELI
FVTGRSKRAIEDHFDKAYELEAALEAKNKQDLLHLVRSVKPDNVDCVYIRQSEPLGLGHA
VLCAEKLVGDEPFAIILADDLLDGQPPVLSQMLKVHEEQEGSVLAVEKIDPSKSSSYGII
SGKEVQQGIYRLDGIVEKPKPADAPSNLAVVGRYVLSSKIFDHIRNVKPGAGGEIQLTDA
IAALLKDEPVFGYEYDGVRYDCGSKLGYLKASVDFALRHPEVGEDFAEYLKSWSLK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacatttcagctccaaaaaggtcactaaagcagtttttccagtagccggtttt
ggtacgcgctttttgccagcaaccaaggcaagcccaaaagaaatgctcaatgtcgtagat
aagccactcattcaatatgcagtggatgaagcgattgctgccggcattaccgaattaata
tttgtaaccggtcgtagcaaacgcgcaattgaagaccactttgataaagcttatgaatta
gaagctgctcttgaagcaaagaataagcaagacctactccatctagtgcgcagcgttaag
cccgacaatgtcgattgcgtttacattcgccaatctgaacctctgggtttgggtcatgca
gttttatgtgctgaaaaattagttggagatgagccgtttgccattatcttggccgacgat
cttttggatggacaaccaccagtgctttcgcaaatgctcaaagtgcatgaagagcaagag
ggttcagtgctcgctgttgagaagatcgatccatccaaatcgagctcctatggcatcatt
tcaggtaaggaagtgcaacaaggcatctatcgcttagatggcattgttgaaaagccaaag
ccagcagatgcaccatctaatctcgcggttgtaggtcgctatgttctgtcttccaaaatt
tttgatcacattcgcaatgtcaagccaggtgctggtggtgaaattcaactgacggatgcc
attgcggccttgctcaaggatgagcccgtgtttggatatgagtacgacggcgtgcgttat
gactgcggtagcaaattgggctatctcaaagcctctgttgactttgcattgcgtcaccca
gaagtaggcgaagattttgcagaatacttaaaaagctggtccttgaaataa

DBGET integrated database retrieval system