KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1717Help
Entry
Pnuc_1717         CDS       T00502                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pnuc_1717
   00052 Galactose metabolism
    Pnuc_1717
   00500 Starch and sucrose metabolism
    Pnuc_1717
   00520 Amino sugar and nucleotide sugar metabolism
    Pnuc_1717
Enzymes [BR:pnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pnuc_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1787764..1788654
Genome map
AA seq 296 aa AA seqDB search
MSLHFSSKKVTKAVFPVAGFGTRFLPATKASPKEMLNVVDKPLIQYAVDEAIAAGITELI
FVTGRSKRAIEDHFDKAYELEAALEAKNKQDLLHLVRSVKPDNVDCVYIRQSEPLGLGHA
VLCAEKLVGDEPFAIILADDLLDGQPPVLSQMLKVHEEQEGSVLAVEKIDPSKSSSYGII
SGKEVQQGIYRLDGIVEKPKPADAPSNLAVVGRYVLSSKIFDHIRNVKPGAGGEIQLTDA
IAALLKDEPVFGYEYDGVRYDCGSKLGYLKASVDFALRHPEVGEDFAEYLKSWSLK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtcattacatttcagctccaaaaaggtcactaaagcagtttttccagtagccggtttt
ggtacgcgctttttgccagcaaccaaggcaagcccaaaagaaatgctcaatgtcgtagat
aagccactcattcaatatgcagtggatgaagcgattgctgccggcattaccgaattaata
tttgtaaccggtcgtagcaaacgcgcaattgaagaccactttgataaagcttatgaatta
gaagctgctcttgaagcaaagaataagcaagacctactccatctagtgcgcagcgttaag
cccgacaatgtcgattgcgtttacattcgccaatctgaacctctgggtttgggtcatgca
gttttatgtgctgaaaaattagttggagatgagccgtttgccattatcttggccgacgat
cttttggatggacaaccaccagtgctttcgcaaatgctcaaagtgcatgaagagcaagag
ggttcagtgctcgctgttgagaagatcgatccatccaaatcgagctcctatggcatcatt
tcaggtaaggaagtgcaacaaggcatctatcgcttagatggcattgttgaaaagccaaag
ccagcagatgcaccatctaatctcgcggttgtaggtcgctatgttctgtcttccaaaatt
tttgatcacattcgcaatgtcaagccaggtgctggtggtgaaattcaactgacggatgcc
attgcggccttgctcaaggatgagcccgtgtttggatatgagtacgacggcgtgcgttat
gactgcggtagcaaattgggctatctcaaagcctctgttgactttgcattgcgtcaccca
gaagtaggcgaagattttgcagaatacttaaaaagctggtccttgaaataa

DBGET integrated database retrieval system