KEGG   Polynucleobacter asymbioticus: Pnuc_1831Help
Entry
Pnuc_1831         CDS       T00502                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pnu  Polynucleobacter asymbioticus
Pathway
pnu00020  Citrate cycle (TCA cycle)
pnu00640  Propanoate metabolism
pnu00660  C5-Branched dibasic acid metabolism
pnu01100  Metabolic pathways
pnu01110  Biosynthesis of secondary metabolites
pnu01120  Microbial metabolism in diverse environments
pnu01130  Biosynthesis of antibiotics
pnu01200  Carbon metabolism
Module
pnu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnuc_1831
   00640 Propanoate metabolism
    Pnuc_1831
   00660 C5-Branched dibasic acid metabolism
    Pnuc_1831
Enzymes [BR:pnu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pnuc_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A CIDE-N ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABP35044
JGI: Pnuc1831
UniProt: A4SZY0
Position
complement(1911800..1912969)
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQGKELLRQFNVPVPNGIPAFSVDEAVKAAEKLGGPVWVVKAQIHAGGRGKGGGV
KLARSMDEVKKYASEILGMQLKTHQTGPEGQKVNRLLIEDGADIKKEYYFSIVTDRGTQK
NVIMASSEGGMDIEEVAESHPEKIIKVFVDPMVGLTDADCDIVAKGIGVPEASIPMARDV
FKNLYKTYWDTDASLVEINPLILEGNGKIKALDAKFNFDPNALFRHPEIVAYRDIDEEDA
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATAEKVTE
AFKIMLKNKSVEAILVNIFGGIMRCDVIADGVVTACKAVNLTVPLVVRMKGTNEELGKKI
LADSGLPIISADSMAEAATKVVAAVAKNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgagtaccaaggcaaagaacttcttcgccaatttaatgtgcctgttcct
aacggcattcctgcatttagtgttgatgaagcagtgaaagctgctgaaaagcttggtggc
ccagtatgggttgtaaaagcacagattcatgctggtggtcgcggtaaaggtggtggcgtg
aagttggcaagaagcatggatgaggtaaagaaatacgcttctgaaattttgggtatgcag
cttaagacacatcaaactggcccagaaggtcaaaaagtaaaccgcctcctaattgaagat
ggcgctgatattaaaaaagagtattacttcagtatcgttacagaccgaggcacacagaaa
aatgtgatcatggcttctagcgaaggcggtatggatattgaggaagttgctgaatctcac
ccagaaaaaattattaaagtatttgttgatccaatggttggtttgactgatgcagattgc
gacatcgttgccaaaggtattggcgttcctgaagcgtctatcccaatggcgcgcgatgta
tttaaaaacttgtacaagacttactgggataccgacgcttcattggttgaaatcaaccca
ttaattctggaaggtaacggcaagataaaggctttggacgcgaagttcaactttgatcca
aatgcattgttccgtcacccagaaatcgttgcttaccgcgatatcgatgaggaagatgct
gcagaaatcgaagcttctaaatttgatcttgcctatatttcattagacggcaatatcggc
tgtttagtaaatggggctggcttggcgatggctaccatggacaccattaagttatttggt
ggcgagcccgccaacttcttggatgttggtggtggtgcaacagcagaaaaggtaaccgaa
gcattcaagatcatgttgaaaaacaagagcgttgaagcgatcttggtaaatatttttggc
ggcatcatgcgttgtgatgtgattgctgatggtgtggttactgcatgtaaagcagtgaac
ttaactgttcctttggtagtgcgtatgaagggcacaaacgaagagttgggcaagaagatt
cttgcagactctggtttgccaattattagcgctgattcaatggccgaagctgctactaaa
gtagttgctgctgttgccaaaaacaaataa

DBGET integrated database retrieval system