KEGG   Polynucleobacter necessarius subsp. asymbioticus: Pnuc_1879Help
Entry
Pnuc_1879         CDS       T00502                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pnu  Polynucleobacter necessarius subsp. asymbioticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pnu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pnuc_1879 (ruvA)
Enzymes [BR:pnu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pnuc_1879 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1954888..1955469
Genome map
AA seq 193 aa AA seqDB search
MIGRIQGTLVSVHPPRLLVDCQGVGYEIDVPMSTLYQLPEVNQKITLLTHFQVREDAQQL
FGFATEIEREAFRQLIKISGVGSRTALAVLSGMSVNELAQAIALQEAGRLTQVPGIGKKT
AERLCLELKGKLAPDLGITGGKPQAIEATSEVLQALLSLGYSEKEALLALKQIPPETSVS
DGIRMGLKYLSKP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcgcattcaaggtactctcgtttcagttcatcctcctcgtctattggtggat
tgccagggcgttggttatgaaatcgatgtgcccatgagcactttgtatcagctacctgaa
gtaaatcaaaaaattaccctgctcacccactttcaagtacgtgaggatgcgcaacagctt
tttggctttgctaccgagattgagcgtgaagcattcaggcagttaattaaaattagtggg
gtgggctcacgtaccgctcttgcagttctctctggcatgagcgtgaacgaattggctcaa
gcaattgccttgcaagaagctggtcgactcacgcaagtgcctgggattggcaaaaaaact
gctgagcgcctttgcttggagcttaaaggcaaactggcaccagatcttggtattacgggt
ggcaaaccacaagccattgaagcaactagtgaagtattgcaagcgcttttatcattaggt
tactccgaaaaagaagcgcttttagcgctgaagcaaatcccaccagagactagtgtttcc
gatggaattcggatgggtctaaagtatctatctaagccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system