KEGG   Pyrobaculum oguniense: Pogu_0251Help
Entry
Pogu_0251         CDS       T01735                                 

Definition
PTS system alpha-glucoside-specific transporter subunit IICB (EC:3.2.1.1)
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pogu_0251
Enzymes [BR:pog01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Pogu_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215117..216487
Genome map
AA seq 456 aa AA seqDB search
MDVVLFFEVHQPRRLRPDLYRVFPRKPLEGEIFYEELDRHVFERVSERVYRKSTKILLDA
AREVPGLRVTFSVSGLALEQMRRWAPDVLDLFREMAAREVAEFAAQTYYHSLAWFVDREE
FREQVEMQVKAVEELIGYKPHAAENTEFIYNNDVACFLHSMGFSTVVTEGVDWVLGWRSP
NYVYKAWGCDARVLVRNYRLSDDVGFRFGARWWDQWPLTADKYAAWLEATPGDVVLIAVD
YETFGEHHWPESGIHEFLRWLPREIAKRPRLQFATVSDVARSHAPRDVYDVPPWATISWA
DERDLSAWLGNELQRNAFSLLSWVYPYAKALGGEVLKLWRMLSTSDHLYYQATKLGPAGE
VHSYFSPYGSAYKAHDIYMAALATLFVYIREAWNREAAERLVFNDERCFYAEGVRLCSLR
DLRNVDRGYKSRHREDLLRWLTDVFMLSPEEAGSLV
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
gtggatgttgtcctctttttcgaggtgcaccagccgcggaggcttaggccagacctctat
agagtttttccgcgcaagcccctcgagggggagatcttctacgaggagttggataggcat
gtgtttgagagagtttcggagagggtttaccgcaagtccacgaagattctgctagacgcg
gcgagggaggtgcctgggctgagggttactttcagcgttagtggcttggcgcttgagcag
atgaggaggtgggccccagacgtgttggacttgttcagggaaatggcggcgagggaggtg
gcggagttcgcggcgcagacatattaccacagcctggcctggtttgtcgacagggaggag
ttcagagaacaggtggagatgcaggtcaaggcggtggaggagctcatcggctacaagccc
cacgcggcggagaacaccgagttcatctacaacaacgacgtggcatgttttctacactca
atgggcttctccacggtagtcacagagggggtggactgggtgctaggctggcggtcgccg
aattacgtctacaaggcgtgggggtgcgacgcgcgggtgttggtcaggaactaccggctc
agcgacgacgtggggtttaggttcggcgccaggtggtgggatcagtggcccctcacggcg
gataaatacgccgcctggcttgaagcgacacctggcgacgtcgtgttgatagccgtggac
tatgagaccttcggcgagcaccactggccggagagcggaatacacgaattcctaaggtgg
ctaccgcgggagatcgcgaagaggccccgcctgcagttcgcaactgtgagcgatgtagcc
aggagccacgcgccgagggacgtctacgacgtgccgccgtgggccaccataagctgggcc
gacgaacgcgacctctcggcttggttaggcaacgagctccagcgaaatgcattctctttg
ctgagctgggtctacccatacgccaaggccctaggaggagaggtgttgaagctctggagg
atgctttctacaagcgatcacttgtactaccaagcgacgaaattgggtcccgccggcgaa
gttcactcttatttcagcccctacggctctgcctataaagcacatgacatatacatggcc
gccttggctaccctgtttgtgtacataagggaggcgtggaacagagaggcggctgagaga
ctcgtgttcaacgatgagaggtgcttctacgccgagggggtccggctctgttccttgagg
gatctcagaaacgtcgacaggggctataaatcgcgccatagagaagatcttctgaggtgg
ttaaccgacgtttttatgctaagcccagaggaagccggtagcctagtgtag

DBGET integrated database retrieval system