KEGG   Pyrobaculum oguniense: Pogu_0258Help
Entry
Pogu_0258         CDS       T01735                                 

Definition
transcriptional regulator/sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_0258
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_0258
   00052 Galactose metabolism
    Pogu_0258
   00500 Starch and sucrose metabolism
    Pogu_0258
   00520 Amino sugar and nucleotide sugar metabolism
    Pogu_0258
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pogu_0258
   00524 Butirosin and neomycin biosynthesis
    Pogu_0258
Enzymes [BR:pog01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pogu_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(222080..222970)
Genome map
AA seq 296 aa AA seqDB search
MPLYLGVDVGATWTRAVLVDGHANVINRLKIRTSKNPLADVAEAVAGWKFDSIGVGSIGP
MDLRSGWVTNSPNSPARQFPLVEPLKKLGKPVVVANDCVAAVWGEYVFKHGVDNMVYLTL
STGVGVGAVVNGALLLGKDGNAHELGHAVIDFRAGRQCGCGGFGHFEAYIGGANVPKWFR
EVSGEAMADAAEVFRRYRAGDSKAVEFVNLWLDALAAGIATVVAAYDPELLIVGGSVALN
NWDIIIPKLSPRLVKYLGVRPPQILQASFGDDEVAIGAAALAYKTPESLKKFGYPR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgtatctaggcgttgatgtgggagcgacgtggacgagagccgtattggtggat
ggtcatgcaaatgtgattaacaggttgaaaattagaaccagtaaaaacccccttgccgac
gtcgccgaggcagtagcggggtggaagtttgacagtataggcgtgggatccatcgggccc
atggacttgaggagcgggtgggttactaactcgcctaattctccagctaggcagttccca
ctagtcgagccgttgaaaaaactgggcaaaccagtagttgttgcaaacgactgcgtcgca
gcagtgtggggagaatacgtctttaaacacggcgtcgacaacatggtgtacttaactctg
tccactggcgttggggttggcgcggtggttaacggcgctctactgctgggcaaagacggc
aacgctcacgaactgggacacgccgtgatagatttccgtgcgggtcgccagtgcggatgc
ggcggctttggccactttgaggcatatatcggcggggcgaatgtgcccaagtggttccgc
gaagtctccggcgaggcgatggcagatgccgccgaggtgttccgtagatatagagctggg
gattcaaaggcggtggagtttgtcaacctctggcttgacgccttggccgcgggcatagcc
acagtggtggcggcctacgaccccgagctgttaatagtggggggatcagtagccttgaac
aactgggatatcataattcccaagctttccccgcgcttggtgaaatacttaggcgtgcgg
cctccccaaattctccaggcatcttttggagacgacgaggtggcgataggcgccgccgcc
ctcgcttataaaaccccagaaagcttgaaaaagttcggatatcctagatag

DBGET integrated database retrieval system