KEGG   Pyrobaculum oguniense: Pogu_0426Help
Entry
Pogu_0426         CDS       T01735                                 

Definition
2-oxoacid:acceptor oxidoreductase subunit gamma, pyruvate/2-ketoisovalerate family (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_0426
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_0426
   00020 Citrate cycle (TCA cycle)
    Pogu_0426
   00620 Pyruvate metabolism
    Pogu_0426
   00640 Propanoate metabolism
    Pogu_0426
   00650 Butanoate metabolism
    Pogu_0426
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_0426
   00680 Methane metabolism
    Pogu_0426
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pogu_0426
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pogu_0426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(354089..354637)
Genome map
AA seq 182 aa AA seqDB search
MFEAVFLGRGGQGAVTAVQLLAYAAALEGKKAQALPEFGAERRGAIVRAYLRVGDVLLHS
SVKKADYVVVLDGRIVEQIDVRQYGKPGAVYIVNSKTPADWYIAIDATSIALKHGLIVAG
WPVVNLIMAAALAAVSGLVSLDSIVKAIPEYVPKRFVESNIKAVVEGYEVAKRILRPAPS
VD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgaggcagtgtttctgggtcggggaggacaaggggcggtgactgctgtccagctt
ctcgcctatgccgcagccctggagggaaagaaggcacaagcgttgcccgagttcggcgca
gagaggagaggggccatagtgagggcctatctcagagtgggggatgtgcttctacattct
tcggtgaaaaaggcggattatgtggtggtgctggacgggcgtattgttgagcagatcgat
gtgaggcaatacggcaagccgggagccgtgtatatagtgaacagcaagacgccggcggat
tggtacatagccatagacgccacctccatcgccttgaagcacggccttattgtggctggg
tggcctgtggttaatctaataatggcggcggcgctagctgctgtgagtgggctagtttct
ctagacagcatcgtgaaggcgattccagaatacgtacctaagcgatttgtcgagagtaac
ataaaggccgtagtggagggctacgaggttgctaagaggatcttaaggccagcgccctcc
gtcgattga

DBGET integrated database retrieval system