KEGG   Pyrobaculum oguniense: Pogu_0427Help
Entry
Pogu_0427         CDS       T01735                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00010  Glycolysis / Gluconeogenesis
pog00020  Citrate cycle (TCA cycle)
pog00620  Pyruvate metabolism
pog00633  Nitrotoluene degradation
pog00640  Propanoate metabolism
pog00650  Butanoate metabolism
pog00680  Methane metabolism
pog00720  Carbon fixation pathways in prokaryotes
pog01100  Metabolic pathways
pog01120  Microbial metabolism in diverse environments
pog01130  Biosynthesis of antibiotics
pog01200  Carbon metabolism
Module
pog_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_0427
   00020 Citrate cycle (TCA cycle)
    Pogu_0427
   00620 Pyruvate metabolism
    Pogu_0427
   00640 Propanoate metabolism
    Pogu_0427
   00650 Butanoate metabolism
    Pogu_0427
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_0427
   00680 Methane metabolism
    Pogu_0427
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pogu_0427
Enzymes [BR:pog01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pogu_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_16 Fer4_10 Fer4_2 Fer4_9 Fer4_17 Fer4_13 Fer4_8 Fer4_4 Fer4_15 Fer4_22 Fer4_18 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFA38454
UniProt: H6Q760
Position
354786..355034
Genome map
AA seq 82 aa AA seqDB search
MIPLSKPAPASAGITGTWRTYKPVVSLDKCIDCGLCWLYCPESVIDWEKGHKVTIDYTYC
KGCGICADVCPVKAINMIPEEA
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
gtgattcccctctcaaaacccgcacccgcctcagccggcatcaccggcacgtggcgcacc
tataaacccgtcgtaagcctagacaagtgcatagactgcggcctttgttggctctactgc
cccgagtcggtcatagactgggaaaaaggacacaaagtaactatagactacacctactgc
aagggttgcggcatctgcgccgacgtctgccccgtcaaagcaataaacatgatccccgag
gaggcatga

DBGET integrated database retrieval system