KEGG   Pyrobaculum oguniense: Pogu_0685Help
Entry
Pogu_0685         CDS       T01735                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pog  Pyrobaculum oguniense
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_0685
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pogu_0685
   00640 Propanoate metabolism
    Pogu_0685
   00660 C5-Branched dibasic acid metabolism
    Pogu_0685
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_0685
Enzymes [BR:pog01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pogu_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(574626..575774)
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFSKYGVKIPPGRVATTPEEVRKIAEEIGGPVVLKAQVVVAGRGKAGGIK
VAKTPEEAYELATKMFGMNIKGLVVKKIYVTKYVEVDREMYLSLIIDRATRRYLFLASPI
GGVDIEEIAKTQPEKIKRVYVDPSVGLRDYHVRSIVLWLGFKPETAQWRQTSSIVQAMYN
IMVDYDAELVESNPLAVTKEGDVIPLDARVIVDDNALYKHPELEKALEEDPRDVTEFEMY
AKKIGFHYVELDGDIGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASRDVVKEALKV
LLRHPRVKVIFINIFGGITRADEVAAGVEAALAEEGGTNKKIVVRMKGTNEELGRQMLAK
LGIPLYESAEEAAQKAVELARA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgaatatgaggctaaggagcttttttctaaatacggcgtcaagatcccg
cctgggagggttgcgactacgccggaggaggttcggaagatcgcagaggagatcggcggc
ccggtggtactgaaggcgcaggtggttgtggctggccggggcaaggcggggggtataaaa
gttgcgaaaacgccggaggaggcctacgagctcgccacaaagatgttcggcatgaatatc
aaggggctagtggtgaagaagatctacgtgactaagtatgtcgaggtggatcgggagatg
tacctctcgctgattattgacagggctacgcggaggtacctattcctcgcatcccccata
ggcggggtggatattgaggagattgcgaagacgcagccggagaaaataaagcgcgtctac
gtcgacccatcggtggggcttagggattaccacgtccgttctattgtcctgtggctcggc
tttaagccggagacggcacagtggcggcagacgtcgtctatagtacaggcgatgtacaac
ataatggttgactacgatgcggagctggtggagtccaaccccttagcagtcacaaaggag
ggggatgtcatccccctagacgccagggtaatagttgacgacaacgccttgtacaaacac
cccgagctggaaaaggcgctggaggaggacccccgcgacgtcaccgagttcgagatgtac
gcgaagaagatcggctttcactacgtcgagcttgacggcgatattggcatcatcggcaac
ggcgccgggctgaccatgtccaccatggacctggtctaccacttcggaggccgcccggcg
aatttcctggacataggaggcggggcatcgcgcgatgttgttaaagaggcgttgaaggtg
ctcctaagacacccccgggtgaaggtgatattcattaacatattcggcggcattactagg
gcagacgaggttgcggccggcgtagaggcggcgttggccgaggagggtgggacaaataag
aagatcgttgtgaggatgaaaggcaccaacgaggagctgggaaggcagatgttggctaag
ctgggcattccgctttacgaaagcgcagaagaggcagcacagaaagcagtggagttagcg
agggcatga

DBGET integrated database retrieval system