KEGG   Pyrobaculum oguniense: Pogu_0685Help
Entry
Pogu_0685         CDS       T01735                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00020  Citrate cycle (TCA cycle)
pog00640  Propanoate metabolism
pog00660  C5-Branched dibasic acid metabolism
pog00720  Carbon fixation pathways in prokaryotes
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01120  Microbial metabolism in diverse environments
pog01130  Biosynthesis of antibiotics
pog01200  Carbon metabolism
Module
pog_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pog_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pogu_0685
   00640 Propanoate metabolism
    Pogu_0685
   00660 C5-Branched dibasic acid metabolism
    Pogu_0685
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_0685
Enzymes [BR:pog01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pogu_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFA38712
UniProt: H6Q7G8
Position
complement(574626..575774)
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFSKYGVKIPPGRVATTPEEVRKIAEEIGGPVVLKAQVVVAGRGKAGGIK
VAKTPEEAYELATKMFGMNIKGLVVKKIYVTKYVEVDREMYLSLIIDRATRRYLFLASPI
GGVDIEEIAKTQPEKIKRVYVDPSVGLRDYHVRSIVLWLGFKPETAQWRQTSSIVQAMYN
IMVDYDAELVESNPLAVTKEGDVIPLDARVIVDDNALYKHPELEKALEEDPRDVTEFEMY
AKKIGFHYVELDGDIGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASRDVVKEALKV
LLRHPRVKVIFINIFGGITRADEVAAGVEAALAEEGGTNKKIVVRMKGTNEELGRQMLAK
LGIPLYESAEEAAQKAVELARA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcacgaatatgaggctaaggagcttttttctaaatacggcgtcaagatcccg
cctgggagggttgcgactacgccggaggaggttcggaagatcgcagaggagatcggcggc
ccggtggtactgaaggcgcaggtggttgtggctggccggggcaaggcggggggtataaaa
gttgcgaaaacgccggaggaggcctacgagctcgccacaaagatgttcggcatgaatatc
aaggggctagtggtgaagaagatctacgtgactaagtatgtcgaggtggatcgggagatg
tacctctcgctgattattgacagggctacgcggaggtacctattcctcgcatcccccata
ggcggggtggatattgaggagattgcgaagacgcagccggagaaaataaagcgcgtctac
gtcgacccatcggtggggcttagggattaccacgtccgttctattgtcctgtggctcggc
tttaagccggagacggcacagtggcggcagacgtcgtctatagtacaggcgatgtacaac
ataatggttgactacgatgcggagctggtggagtccaaccccttagcagtcacaaaggag
ggggatgtcatccccctagacgccagggtaatagttgacgacaacgccttgtacaaacac
cccgagctggaaaaggcgctggaggaggacccccgcgacgtcaccgagttcgagatgtac
gcgaagaagatcggctttcactacgtcgagcttgacggcgatattggcatcatcggcaac
ggcgccgggctgaccatgtccaccatggacctggtctaccacttcggaggccgcccggcg
aatttcctggacataggaggcggggcatcgcgcgatgttgttaaagaggcgttgaaggtg
ctcctaagacacccccgggtgaaggtgatattcattaacatattcggcggcattactagg
gcagacgaggttgcggccggcgtagaggcggcgttggccgaggagggtgggacaaataag
aagatcgttgtgaggatgaaaggcaccaacgaggagctgggaaggcagatgttggctaag
ctgggcattccgctttacgaaagcgcagaagaggcagcacagaaagcagtggagttagcg
agggcatga

DBGET integrated database retrieval system