KEGG   Pyrobaculum oguniense: Pogu_0774Help
Entry
Pogu_0774         CDS       T01735                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00260  Glycine, serine and threonine metabolism
pog00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01130  Biosynthesis of antibiotics
pog01230  Biosynthesis of amino acids
Module
pog_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pogu_0774
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pogu_0774
Enzymes [BR:pog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pogu_0774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE IGPS ThiG IMPDH PcrB FMN_dh His_biosynth
Motif
Other DBs
NCBI-ProteinID: AFA38801
UniProt: H6Q871
Position
complement(654754..655461)
Genome map
AA seq 235 aa AA seqDB search
MLRRPGLGVYLLAGWPSEKAYREAVAGMDGLVDFFELGIPSPNPKYDGPFIRKAHREVSA
PVWDKPSAPTYLMGYWEDARGRPADLFERAASLGARGVLLPDLLIDFPEELDIYLKLTRE
NGLAPVFFLPSKFPYALAKRLAASQPDFIYIGLYAATGIELPVYVERNVKIMRELAPDVY
IVAGFAVDSPAKAAKLVRAGADGVVVGTAFMRRLQKDVREALAFLAEVKKALLDL
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctcagaaggccgggcctcggggtctacttgctggccggctggcccagcgaaaaggcg
tacagagaggccgtggccgggatggacgggttggtggacttcttcgagctggggatcccc
agccccaacccgaaatacgacggcccgtttataagaaaagcccacagagaggtgtcggcg
ccggtttgggataagccgagcgcccccacctaccttatggggtattgggaagatgcccgc
ggccgacccgcagacctttttgagagggccgcctcgctgggggcgaggggggtgctactg
ccggacttgctcatagacttccccgaggagctcgatatctacctcaagctgacgcgggag
aatggccttgcccccgtgttcttcctccctagcaagttcccctacgccttggcgaagaga
ctggccgcctcccagcctgatttcatttacatcggcctatacgccgccacgggcatagag
ctaccggtatacgtggagcgcaacgtgaagatcatgagggagctggcccccgacgtctac
atcgtggcgggattcgccgtggacagcccggccaaggcggcgaagctggtgagggccggc
gcagacggcgtagtcgtgggcaccgccttcatgcgcaggttgcagaaggacgtgagggag
gcattggccttcttagccgaggttaaaaaagcgcttctagacctctga

DBGET integrated database retrieval system