KEGG   Pyrobaculum oguniense: Pogu_0778Help
Entry
Pogu_0778         CDS       T01735                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pogu_0778
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pogu_0778
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pogu_0778
Enzymes [BR:pog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pogu_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(658339..659568)
Genome map
AA seq 409 aa AA seqDB search
MVDRWYNIAADLPAVLAPPKDPDEGESRIGLLTRILPSALIDQEFSAERWISIPEEVRDA
YRRVGRPTPLLRAEGLERALGTGVRIYYKYEGVLPVGSHKLNTALAQAYYAKADGAVEVA
TETGAGQWGMAVSLAAALFGLRAVVFMTRSSYNSKRQRLTFMRTYGATVYPSPSEVTEAG
RRHYRPDHPGSLGIAISEAVEYVLSGEKRRYLPGSVLEFVLMHQTVIGLEAVRQLPEEPD
AAVACVGGGSNFAGFTYPMIGMKLRGEGFDKTRFVAVEAEAAPKLTKGEYKYDFPDAVGV
LPMIKMYTLGHDYVPPPVHAAGLRYHGAAPSLSLLRKLGIVEPLSYPQEEVMKAAVLFAR
TEGIVPAPESAHAIRAVLDLAKKLPRGSVIAFNLSGHGLLDSDAYEKFL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtggtagacaggtggtacaacatcgccgctgacctccccgctgtcttggctccccccaaa
gacccagacgagggcgagagtagaatcggcctgcttacgagaatactcccatccgcgctt
atagaccaagaattttctgcggagcgctggatttctattccagaagaggttagagacgcg
taccggcgtgttggtaggccgacgcccctcctccgcgccgaggggctggagagggctctg
ggcacgggggtgaggatatactacaagtacgagggggtgctcccagtgggtagccacaag
ctcaacacagccctggcacaggcctactacgccaaggccgacggagcggtggaagtggcc
accgagacgggggcggggcagtggggcatggctgtctccctcgcggcagctctcttcggc
ctaagagccgtggtgtttatgacccgctcctcctacaactcaaagaggcagaggctgacc
tttatgaggacttacggcgcgacggtgtaccccagccccagcgaagtgacggaggcgggg
aggaggcactaccggccggaccacccaggctcgctggggatcgcaatatcggaggcggtg
gagtacgtcctatccggcgagaagaggcgctacctcccgggcagcgtcttggagttcgtg
ctcatgcaccagaccgtcataggactagaggcggttaggcaactgccggaggagccggac
gccgccgtggcctgcgtcggcggggggtcgaacttcgccggctttacctaccccatgatc
gggatgaagctgaggggcgagggcttcgacaagacgaggttcgtcgcagttgaggcggaa
gccgcccccaagctcacaaagggggagtacaaatacgacttcccagacgccgtgggggtc
ctccccatgatcaagatgtacaccctaggccacgactacgtcccgccgcccgtccacgcg
gccggcctccggtaccacggcgccgcgccgtccctctccttgcttcggaaattggggata
gtggagccgctctcctacccccaggaggaggtcatgaaagccgcggtgctcttcgcgagg
acggagggcattgtaccggcgccggagtcggcacacgcgataagggcagtgctagacctc
gcaaaaaagctcccacgcggctcggtaatagcgttcaacctctccggccacggcctcctc
gactccgacgcctacgagaagttcttgtaa

DBGET integrated database retrieval system