KEGG   Pyrobaculum oguniense: Pogu_0827Help
Entry
Pogu_0827         CDS       T01735                                 

Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pog01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pog00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pog00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pog00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:pog00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:pog00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(700115..702079)
Genome map
AA seq 654 aa AA seqDB search
MSLPQKFKAWEGLYKRWAEDPEGFWREFVERTSHLIYWAKKPEKIFEWQPPEPFKWFVGG
YTNAGYSAVDYKTGLLGDKVAYIYLNPEAGAERKVTYGELAALVYKFSAAMRATGVKKGD
TILVYMPNSIEAVAAILAAARIGAVSTTVFAGFSPKAVADRIELVEPKIVFTQDHSLRRG
RKIPLKANIDEALKISAWRPSLVVVKKTEEGGDVPMERGRDMWLEEFLEMGKGHSAHPEF
VESNEPLFVLPTSGTTAKPKPVVHVHGGYQVWIVYGALLVYGLSANDLIFNTSDIGWIVG
QSYIVFAPLIMGATSILFDGAIDYPKPDLFWEVVEKYKPTLIWTSPTAARLLMRYGTNLA
RRHDLSSVTRVVTAGEVLNPEVWRWLYEDVFRRRVPVIDHWWQTELAGPTIGYYYALVSG
MPHGLEHMEIKPGSAGVPLPGVEVEVVDERGNPAPPGHKGTLVIKRPHPGMTPTLWRDHQ
RYLNDYWGRYEGKMVYYTGDAAHMDEDGYIWFAGRADEVIKIAGHRIGTIEVESALVSHP
AVAEAAVVGVPDPLRGEAIAAFVVLRPGWQPTEGLKKDLIEHVRKTFGPIAVFAGVEFVN
MLPKTRSGKIMRRVLKRMWTGEPLGDLSTIEDEASIEEVKEAVSKMKFIKTAES
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcctcaaaaattcaaagcatgggaagggctctacaaaagatgggcagaagat
ccggaagggttttggcgtgagtttgtagaaagaacctcgcacctcatctactgggctaaa
aaaccggagaagatattcgagtggcaacctcccgagccgttcaagtggttcgttggcggc
tatacaaacgcaggttacagcgcggtagattataagacggggcttctaggcgacaaggtc
gcctacatctacctaaaccccgaggcgggggcggagcggaaggtgacatacggcgagttg
gcggcgctggtgtacaagttcagcgccgccatgagagctaccggggtgaagaagggggac
accatcctcgtctacatgcctaactcaattgaggccgtcgcggctatactggccgcggcg
cgtataggagccgtctccaccaccgtctttgccggattttcgccgaaggcggtggccgat
aggatagagctggtggagcccaagatcgtattcacccaagaccactcgctacgcagagga
agaaaaatcccgcttaaggcaaatatcgacgaggcgcttaagatatcggcgtggcgccca
tccctcgtggttgttaagaagacggaggagggaggcgacgtgcccatggagagggggcgg
gacatgtggctggaggagtttctcgaaatggggaagggccactcggctcatcccgagttt
gtggagtccaacgagcccctcttcgtcttgcccacctcaggaaccacggcaaagcccaag
cccgtggtacacgtacatggaggctaccaggtatggatagtatacggcgctctgcttgtg
tacggcctctccgccaacgatcttattttcaacacaagcgacatcgggtggatcgtggga
cagagctatatagtgttcgccccgctgattatgggcgccacctctatcctattcgacggc
gctatagactaccccaagcccgacctattctgggaggtcgtggagaagtacaagccgacg
ctgatttggacctcccccacggcggcgaggcttttgatgaggtacggcacaaacttggcc
aggaggcacgacctctcgtcggtaacgcgggtggtcacggctggtgaggtgctgaaccca
gaagtgtggcgctggctgtacgaggacgtgttcaggaggagggtgcccgtaatagaccac
tggtggcagaccgagctggcaggccccactattgggtactactacgcccttgtaagcggc
atgccccacggccttgagcacatggaaattaagccgggctccgccggcgtcccgctaccg
ggcgtcgaggtggaggtagtagacgagaggggcaacccggcgccgcctggccacaagggg
acgttggtgattaaaaggccgcatcccggcatgacgccgacattgtggagggaccaccag
cggtatttaaacgactattggggcagatacgaggggaagatggtttactacacgggcgac
gcggctcacatggatgaagacggctatatctggttcgccgggagggccgatgaggttatt
aaaatcgccgggcacaggataggcaccatagaggtggagtcggccctcgtttcccaccca
gccgtcgcagaggcggctgtggtgggcgtcccagacccgctgaggggcgaggcgattgcc
gccttcgtggtgctgaggccaggctggcaacccacagagggcctcaagaaggatctaatc
gaacatgtgaggaagaccttcggcccaattgcggtgttcgccggggtggagttcgtcaac
atgctccccaaaacccgttcggggaagataatgaggagggtgctaaagcggatgtggaca
ggcgagccgctaggagatctctcaacaatagaagacgaggcgtcgatagaagaggtcaag
gaggctgtctcaaaaatgaagtttattaaaaccgccgaatcttaa

DBGET integrated database retrieval system