KEGG   Pyrobaculum oguniense: Pogu_0827Help
Entry
Pogu_0827         CDS       T01735                                 

Definition
(RefSeq) acyl-coenzyme A synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pog  Pyrobaculum oguniense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pogu_0827
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_0827
   00620 Pyruvate metabolism
    Pogu_0827
   00640 Propanoate metabolism
    Pogu_0827
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pogu_0827
   00680 Methane metabolism
    Pogu_0827
Enzymes [BR:pog01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pogu_0827
Lipid biosynthesis proteins [BR:pog01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pogu_0827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(700115..702079)
Genome map
AA seq 654 aa AA seqDB search
MSLPQKFKAWEGLYKRWAEDPEGFWREFVERTSHLIYWAKKPEKIFEWQPPEPFKWFVGG
YTNAGYSAVDYKTGLLGDKVAYIYLNPEAGAERKVTYGELAALVYKFSAAMRATGVKKGD
TILVYMPNSIEAVAAILAAARIGAVSTTVFAGFSPKAVADRIELVEPKIVFTQDHSLRRG
RKIPLKANIDEALKISAWRPSLVVVKKTEEGGDVPMERGRDMWLEEFLEMGKGHSAHPEF
VESNEPLFVLPTSGTTAKPKPVVHVHGGYQVWIVYGALLVYGLSANDLIFNTSDIGWIVG
QSYIVFAPLIMGATSILFDGAIDYPKPDLFWEVVEKYKPTLIWTSPTAARLLMRYGTNLA
RRHDLSSVTRVVTAGEVLNPEVWRWLYEDVFRRRVPVIDHWWQTELAGPTIGYYYALVSG
MPHGLEHMEIKPGSAGVPLPGVEVEVVDERGNPAPPGHKGTLVIKRPHPGMTPTLWRDHQ
RYLNDYWGRYEGKMVYYTGDAAHMDEDGYIWFAGRADEVIKIAGHRIGTIEVESALVSHP
AVAEAAVVGVPDPLRGEAIAAFVVLRPGWQPTEGLKKDLIEHVRKTFGPIAVFAGVEFVN
MLPKTRSGKIMRRVLKRMWTGEPLGDLSTIEDEASIEEVKEAVSKMKFIKTAES
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcctcaaaaattcaaagcatgggaagggctctacaaaagatgggcagaagat
ccggaagggttttggcgtgagtttgtagaaagaacctcgcacctcatctactgggctaaa
aaaccggagaagatattcgagtggcaacctcccgagccgttcaagtggttcgttggcggc
tatacaaacgcaggttacagcgcggtagattataagacggggcttctaggcgacaaggtc
gcctacatctacctaaaccccgaggcgggggcggagcggaaggtgacatacggcgagttg
gcggcgctggtgtacaagttcagcgccgccatgagagctaccggggtgaagaagggggac
accatcctcgtctacatgcctaactcaattgaggccgtcgcggctatactggccgcggcg
cgtataggagccgtctccaccaccgtctttgccggattttcgccgaaggcggtggccgat
aggatagagctggtggagcccaagatcgtattcacccaagaccactcgctacgcagagga
agaaaaatcccgcttaaggcaaatatcgacgaggcgcttaagatatcggcgtggcgccca
tccctcgtggttgttaagaagacggaggagggaggcgacgtgcccatggagagggggcgg
gacatgtggctggaggagtttctcgaaatggggaagggccactcggctcatcccgagttt
gtggagtccaacgagcccctcttcgtcttgcccacctcaggaaccacggcaaagcccaag
cccgtggtacacgtacatggaggctaccaggtatggatagtatacggcgctctgcttgtg
tacggcctctccgccaacgatcttattttcaacacaagcgacatcgggtggatcgtggga
cagagctatatagtgttcgccccgctgattatgggcgccacctctatcctattcgacggc
gctatagactaccccaagcccgacctattctgggaggtcgtggagaagtacaagccgacg
ctgatttggacctcccccacggcggcgaggcttttgatgaggtacggcacaaacttggcc
aggaggcacgacctctcgtcggtaacgcgggtggtcacggctggtgaggtgctgaaccca
gaagtgtggcgctggctgtacgaggacgtgttcaggaggagggtgcccgtaatagaccac
tggtggcagaccgagctggcaggccccactattgggtactactacgcccttgtaagcggc
atgccccacggccttgagcacatggaaattaagccgggctccgccggcgtcccgctaccg
ggcgtcgaggtggaggtagtagacgagaggggcaacccggcgccgcctggccacaagggg
acgttggtgattaaaaggccgcatcccggcatgacgccgacattgtggagggaccaccag
cggtatttaaacgactattggggcagatacgaggggaagatggtttactacacgggcgac
gcggctcacatggatgaagacggctatatctggttcgccgggagggccgatgaggttatt
aaaatcgccgggcacaggataggcaccatagaggtggagtcggccctcgtttcccaccca
gccgtcgcagaggcggctgtggtgggcgtcccagacccgctgaggggcgaggcgattgcc
gccttcgtggtgctgaggccaggctggcaacccacagagggcctcaagaaggatctaatc
gaacatgtgaggaagaccttcggcccaattgcggtgttcgccggggtggagttcgtcaac
atgctccccaaaacccgttcggggaagataatgaggagggtgctaaagcggatgtggaca
ggcgagccgctaggagatctctcaacaatagaagacgaggcgtcgatagaagaggtcaag
gaggctgtctcaaaaatgaagtttattaaaaccgccgaatcttaa

DBGET integrated database retrieval system