KEGG   Pyrobaculum oguniense: Pogu_0902Help
Entry
Pogu_0902         CDS       T01735                                 

Definition
dihydropteroate synthase-related enzyme (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pog  Pyrobaculum oguniense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pogu_0902
Enzymes [BR:pog01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Pogu_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765509..766411
Genome map
AA seq 300 aa AA seqDB search
MVIRGYLGSLPVGDDLPARVMAVINLSPESFYKGSVADEDPVERALFLERHADVIDVGAM
STAPYLETWVPPEKELERLKKALPEIVKSVKIPVSVDTYRPQVAEYALKVGASIINDVTG
GKLYPEMCRIVADYGASVVLMAREREPRPGVDPITRVLDALRDSITHFEKCGVDSGRIVV
DPGVGFPTLPPGDQPYVVKGEYRHGDPQWPWWKWDLYILSRLPSLRVLGKPILVGVSRKS
FLRKIAGVATPDEVLPASLAAEALAVYKGAHVIRTHNPAETRQVVRLAETLRSVELGKEV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcaggggatatctcggtagcctaccagttggtgacgacttgccggcaagggtg
atggccgtaataaacctgtcacctgagtccttctacaaagggtcagttgcggacgaagac
cccgtagaaagggcgctattcctcgagaggcacgcggacgtgatcgacgtgggggcaatg
tccacagcgccgtacctagagacttgggtccccccagaaaaggagctagagaggctcaag
aaggcactgccagagatcgtgaagtcggtaaaaatcccagtaagcgtcgacacttacagg
ccccaggtggctgaatacgcccttaaggttggcgcttctattataaacgacgtgaccggc
gggaagctctatccagagatgtgcagaatcgtggcggactacggcgcctcggtggtgctg
atggccagggaaagagagccgaggcctggcgtggacccaatcacccgggtattagacgcc
ctgcgggactcgataacccacttcgagaaatgcggcgtcgatagtggcaggatagtggta
gacccaggggttgggttccccaccctcccgccaggagaccagccgtatgtagtgaagggc
gagtaccgtcacggcgacccccagtggccttggtggaaatgggacttgtacatattatcg
cgcctccccagcctccgcgtgttgggcaaacccatactagtcggcgtttctagaaagtcg
tttctccgtaaaatcgccggcgttgcgacccccgacgaggtcctgccggcgtcacttgct
gcggaggccctagcggtgtacaaaggcgcccatgtaattaggacgcacaaccccgccgag
actaggcaagtggtaagactagccgagactctgaggtcagtagaactcggcaaagaagtc
taa

DBGET integrated database retrieval system