KEGG   Pyrobaculum oguniense: Pogu_1068Help
Entry
Pogu_1068         CDS       T01735                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase, dihydrolipoamide acyltransferase (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pog  Pyrobaculum oguniense
Pathway
pog00010  Glycolysis / Gluconeogenesis
pog00020  Citrate cycle (TCA cycle)
pog00620  Pyruvate metabolism
pog01100  Metabolic pathways
pog01110  Biosynthesis of secondary metabolites
pog01120  Microbial metabolism in diverse environments
pog01130  Biosynthesis of antibiotics
pog01200  Carbon metabolism
Module
pog_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pog00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pogu_1068
   00020 Citrate cycle (TCA cycle)
    Pogu_1068
   00620 Pyruvate metabolism
    Pogu_1068
Enzymes [BR:pog01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pogu_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 HlyD_D23 DUF2118 PTS_EIIA_1 NQRA YqfD RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AFA39095
UniProt: H6Q8L3
Position
907689..908915
Genome map
AA seq 408 aa AA seqDB search
MIEFKFPDLGEGLVEGEIVKWHVKEGDFVKEGDPLVDVMTEKANVTLPAPATGKVVKILA
KEGEIVKVGQVLCVIEEVAAQEAPPKAPAAEAPTSQKVAAMPAARRLARELGIDLSKVKG
TGPGGVITVEDVRRAAEELARQEKAPPAPPPAAVQPPPAIAQPQAPAAAQLPQPVAEEER
IPVRGIRRAVAEKMAKSASAIPHAYHFEEVDVTELVSLRERLRQEAERLGVKLTYLPFVA
KAVAVALREFPMLNSSFDEERGEIVVKRRIHLGFAVDTEQGLMVVVVRDADKKSVLEIAR
ELNALAERARAGKASVDEVRGSTFTITNIGAIGGVGGLPIINYPEAAIMALGKIRKIPRV
VNGAVVPRDVMNVVVGFDHRVVDGAYVARFTNRVKELLEDVGKLLLYI
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagtttaagttccccgacttgggggaggggctcgttgagggcgaaatcgtcaag
tggcacgtgaaggagggggatttcgtgaaggagggcgatccccttgtggatgttatgacg
gagaaggccaacgtgacgttgcctgcccccgccacaggcaaggttgtgaagatactcgcg
aaggagggggagatcgtgaaggtggggcaggtcctctgcgtcatagaggaagttgccgcc
caagaggcgccgcccaaggcgcctgccgccgaggcgccgacctcccagaaggtcgctgca
atgccggcggcgaggaggctggccagggagctgggaatagatctgtctaaggtgaagggg
accgggccgggcggggtgatcaccgtcgaggacgtgaggcgcgcggccgaggagctggcg
aggcaagagaaggcgccgcccgccccgccgccggcggccgtccagccgcccccggcgatt
gcccagccccaggctccggcagcagcccagttgcctcaaccggttgctgaggaggagagg
ataccagtgagggggatcagaagggccgtcgccgagaagatggccaagtctgcatccgcc
ataccccacgcctaccacttcgaggaggtggacgtcacggagctcgtctcgctgagggag
aggctgaggcaggaggcggagaggctgggggttaagctgacctacctccccttcgtggcc
aaggcggtcgcggtggcgctgagggagttccccatgttgaactccagcttcgacgaggag
aggggcgagatcgtggtgaagaggaggatacacttaggcttcgccgtggacaccgagcag
gggctgatggtcgtggtggtgagagatgccgacaagaagagcgtgttggagatagcgagg
gagctcaacgccttggcggagagggcgagggccggcaaggcctccgtggacgaggtcagg
ggatccaccttcaccatcaccaacataggcgccatagggggagtggggggcttgcccatc
ataaactaccccgaggcggcgataatggccctgggcaagatcaggaagatccccagggta
gtaaacggcgcggtcgtccccagagacgtcatgaacgtggtggtggggttcgaccacagg
gtggtggacggggcatacgtggcgaggttcaccaacagagtcaaggagctgctggaggac
gtgggcaagctcctcctgtatatatga

DBGET integrated database retrieval system