KEGG   Pyrobaculum oguniense: Pogu_1085Help
Entry
Pogu_1085         CDS       T01735                                 

Definition
Aldehyde:ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pog  Pyrobaculum oguniense
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pog01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pog00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929526..931427
Genome map
AA seq 633 aa AA seqDB search
MAVKGVNGVVGFVNLSTGEVKKVQIPAVVYRNFLGGYGLGAWFVYRNMQRGADPLGPGNV
LGIVSGLLNAAGIPMTGRSAAVGKSPLTGGWGDANAGGRFGPKLMEAGLDAIFVTGAAEK
PVYILVENGDIYIERASDLWGKTTREAEDELRRRHKGSQAVVIGPAGERLQLIAAIINEY
GRAYGRSGLGAVMGSKKLKAIVAVGDKKPEVYDRELVRQKVVEMAQMLRTTRAKAYEIWH
KYGTIYTLDSSVMSGDTPIKNWAGIGPRDYGEKNLEKFGTNTVIRDNVKPYACASCPVAC
GAWIRRATRYGVVEGHRLEYETASLFGPALLNADQDSVVYAGELCNLYGLDTISTANVVG
FAFELYERGILTERDVGFPLKWGDPDAVVKLVEIIGKAEGIGKVLGQGVKKAAEILGAGQ
YAMHVGGQELPAHHPQYLPGLAIAYTGDPTPARHTAGGVHWWGEGGKRLWAPFDLGQDLG
ASPKYEYGDKGRKAALITMAVQVENALGFCQFSSAVIYRTLPYADLIYAVTGMKYTPEEL
LKVGQRIQTLRQLFNVREGVNPREWRLPRGVLEPFPEGPLAGVRLTEEDVERMRAQYWEA
LGWDPATGYPRRATVQELGLAEIAADVLDLLPP
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggcggttaaaggagtcaacggggttgtgggttttgtaaatctgtctactggcgaagtg
aagaaggtccagatcccagccgtagtctacagaaacttcctcgggggctacggcctcggg
gcctggttcgtctaccggaacatgcaacggggggccgaccccctgggccccggcaacgtg
ctaggcattgtctcggggcttctaaacgccgcgggcatccccatgactgggaggtcggcg
gcggtggggaagtcccccctgacagggggctggggagacgccaacgccggcgggaggttc
gggcctaagctcatggaggcggggctagacgccatattcgtaacaggagccgccgagaag
ccggtgtacatcctcgtggagaacggcgacatttatatagaaagggcctccgacctctgg
ggcaagaccacgagggaggcggaggacgagcttaggcggaggcataagggctcccaggct
gtggtaatcggcccggcgggggagaggctacagctgatagccgcaataattaacgagtac
gggagggcctacggccgctcgggcctaggcgccgtcatggggagcaagaagctcaaggcg
atagtggcggtgggggacaagaagccagaggtgtacgaccgggagctcgtgaggcagaaa
gtagtggagatggcccagatgctcaggacaaccagggccaaggcatatgagatatggcac
aaatacgggacgatatacaccctggactccagcgtcatgtctggcgacacgcccataaaa
aactgggcgggcattgggccaagggactacggcgagaagaacttggagaagttcggcaca
aacacggtgataagggacaacgtcaagccctacgcctgtgccagttgcccagtggcctgc
ggcgcctggataaggagggccacgaggtacggcgtggtggaggggcacaggctggagtac
gagacggcctccctcttcggccccgcgttgctcaacgcagaccaagactcggtggtatac
gccggagagctgtgcaacctctacggcctagacacgatatcgacggcaaacgtagtgggg
ttcgcctttgagctctacgagaggggcatcctcacggagagggacgtcggcttccccctg
aagtggggtgatccagacgccgtggtcaagctggtggagattattgggaaggccgagggc
attggcaaagtgctcggccaaggagtcaaaaaagccgcggagatcctaggcgcggggcaa
tacgccatgcacgtagggggacaggagctccccgcccaccacccccagtacctgcccggc
ctcgccatcgcctacaccggcgaccccaccccggcgaggcacaccgccggcggcgtccac
tggtggggtgagggaggtaagaggctctgggcccccttcgacctggggcaagacctcggc
gcctcgcccaagtacgaatacggcgacaagggacgcaaagccgccctaatcacaatggcc
gtccaggtggagaacgccctgggcttctgccagttctcctccgcagtgatataccggaca
ttgccctacgccgacttaatatacgcagtaactgggatgaagtacaccccagaagagctt
ttgaaggtaggccagaggatacaaaccctaagacagctgttcaacgtaagggagggggta
aacccccgcgagtggaggctccccaggggggtgctggagcccttccccgaggggcccctc
gcaggtgtgaggctaaccgaggaggacgtggagaggatgagggcgcagtactgggaagca
ctgggctgggaccccgccacgggctaccccagaagagccacggtacaagagctggggcta
gcagaaatcgcggcagacgtcctggaccttttaccaccctaa

DBGET integrated database retrieval system